GRK3 Picoband polyclonal, anti-human

GRK3 Picoband polyclonal, anti-human

€455.00
In stock
SKU
AC-ABO12368
Catalog Number: AC-ABO12368
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB
Datasheet
Request Information
Description: Rabbit IgG polyclonal antibody for Beta-adrenergic receptor kinase 2(ADRBK2) detection. Tested with WB in Human.Protein Name: Beta-adrenergic receptor kinase 2

Protein Function:
Specifically phosphorylates the agonist-occupied form of the beta-adrenergic and closely related receptors.

Other Names: Beta-adrenergic receptor kinase 2, Beta-ARK-2, 2.7.11.15, G-protein-coupled receptor kinase 3 {ECO:0000312|MIM:109636}, GRK3 {ECO:0000312|MIM:109636}, ADRBK2, BARK2

Gene ID: 157

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human GRK3 (635-669aa ESDPEFVQWKKELNETFKEAQRLLRRAPKFLNKPR), different from the related mouse and rat sequences by five amino acids.

Calculated MW: 79710

Purification: Immunogen affinity purified.

Format: Lyophilized

Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
More Information
Is Featured? No
Write Your Own Review
You're reviewing:GRK3 Picoband polyclonal, anti-human