GRK3 polyclonal, anti-human

Quantity: 100 µg

Background:
Beta-adrenergic receptor kinase 2 (beta-ARK-2), also known as G-protein-coupled receptor kinase 3 (GRK3), is an enzyme that in humans is encoded by the ADRBK2 gene. The human ADRBK2 gene is located on 22q11. The beta-adrenergic receptor kinase specifically phosphorylates the agonist-occupied form of the beta-adrenergic and related G protein-coupled receptors. Overall, the beta adrenergic receptor kinase 2 has 85% amino acid similarity with beta adrenergic receptor kinase 1, with the protein kinase catalytic domain having 95% similarity. These data suggest the existence of a family of receptor kinases which may serve broadly to regulate receptor function.

Description:
Rabbit IgG polyclonal antibody for Beta-adrenergic receptor kinase 2 (ADRBK2) detection. Tested with WB in Human.

Synonyms:
ADRBK2 antibody, Adrenergic, beta, receptor kinase 2 antibody, ARBK2_HUMAN antibody, BARK2 antibody, Beta adrenergic receptor kinase 2 antibody, Beta ARK 2 antibody, Beta-adrenergic receptor kinase 2 antibody, Beta-ARK-2 antibody, EC 2.7.11.15 antibody, G protein coupled receptor kinase 3 antibody, G-protein-coupled receptor kinase 3 antibody, GRK3 antibody

Isotype: Rabbit polyclonal IgG

Immunogen:
A synthetic peptide corresponding to a sequence at the C-terminus of human GRK3 (635-669aa ESDPEFVQWKKELNETFKEAQRLLRRAPKFLNKPR), different from the related mouse and rat sequences by five amino acids.

Form: Lyophilized; Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Specificity:
No cross reactivity with other proteins.

Reactivity: Reacts with: human

Applications: WB

Reconstitution:
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.