GRK5 polyclonal, anti-human, mouse, rat

GRK5 polyclonal, anti-human, mouse, rat

€384.00
In stock
SKU
ARP-10-P9708
Catalog Number: 10-P9708
Isotype: rabbit polyclonal IgG

Information
Questions? Contact us!


Quantity: 100 µg

Background:
G protein-coupled receptor kinase 5 is an enzyme that in humans is encoded by the GRK5 gene. It is mapped to 10q26.11. This gene encodes a member of the guanine nucleotide-binding protein (G protein)-coupled receptor kinase subfamily of the Ser/Thr protein kinase family. The protein phosphorylates the activated forms of G protein-coupled receptors thus initiating their deactivation. It has also been shown to play a role in regulating the motility of polymorphonuclear leukocytes (PMNs).

Description:
Rabbit IgG polyclonal antibody for G protein-coupled receptor kinase 5 (GRK5) detection. Tested with WB, IHC-P in Human, Rat, Mouse.

Synonyms:
FLJ39780 antibody, FP2025 antibody, G protein coupled receptor kinase 5 antibody, G protein coupled receptor kinase GRK5 antibody, G protein-coupled receptor kinase 5 antibody, G protein-coupled receptor kinase GRK5 antibody, GPRK5 antibody, GRK-pan antibody, GRK5 antibody, GRK5_HUMAN antibody, Pan-GRK antibody

Isotype: Rabbit polyclonal IgG

Immunogen:
A synthetic peptide corresponding to a sequence at the C-terminus of human GRK5 (393-429aa KREEVDRRVLETEEVYSHKFSEEAKSICKMLLTKDAK), different from the related mouse and rat sequences by three amino acids.

Form: Lyophilized; Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Specificity:
No cross reactivity with other proteins.

Reactivity: Reacts with: human, mouse, rat

Applications: WB, IHC-P

Reconstitution:
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.
More Information
Is Featured? No
Write Your Own Review
You're reviewing:GRK5 polyclonal, anti-human, mouse, rat