GRK6 Picoband polyclonal, anti-human, rat

Description: Rabbit IgG polyclonal antibody for G protein-coupled receptor kinase 6(GRK6) detection. Tested with WB in Human;Rat.Protein Name: G protein-coupled receptor kinase 6

Protein Function:
Specifically phosphorylates the activated forms of G protein-coupled receptors. Such receptor phosphorylation initiates beta-arrestin-mediated receptor desensitization, internalization, and signaling events leading to their desensitization. Seems to be involved in the desensitization of D2-like dopamine receptors in striatum and chemokine receptor CXCR4 which is critical for CXCL12-induced cell chemotaxis (By similarity). Phosphorylates rhodopsin (RHO) (in vitro) and a non G-protein-coupled receptor: LRP6 during Wnt signaling (in vitro). .

Other Names: G protein-coupled receptor kinase 6, 2.7.11.16, G protein-coupled receptor kinase GRK6, GRK6, GPRK6

Subcellular Localization: Membrane; Lipid-anchor.

Tissue Specificity: Widely expressed. .

Gene ID: 2870

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human GRK6 (382-417aa QSPFQQRKKKIKREEVERLVKEVPEEYSERFSPQAR), different from the related mouse sequence by four amino acids, and from the related rat sequence by three amino acids.

Calculated MW: 65991

Purification: Immunogen affinity purified.

Format: Lyophilized

Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.