Grp75 Picoband polyclonal, anti-human, mouse, rat
€455.00
In stock
SKU
AC-ABO12328
Catalog Number: AC-ABO12328
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB, IHC-P
Datasheet
Request Information
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB, IHC-P
Datasheet
Request Information
Description: Rabbit IgG polyclonal antibody for Stress-70 protein, mitochondrial(HSPA9) detection. Tested with WB, IHC-P in Human;Mouse;Rat.Protein Name: Stress-70 protein, mitochondrial
Protein Function:
Implicated in the control of cell proliferation and cellular aging. May also act as a chaperone. .
Other Names: Stress-70 protein, mitochondrial, 75 kDa glucose-regulated protein, GRP-75, Heat shock 70 kDa protein 9, Mortalin, MOT, Peptide-binding protein 74, PBP74, HSPA9, GRP75, HSPA9B, mt-HSP70
Subcellular Localization: Mitochondrion . Nucleus, nucleolus .
Gene ID: 3313
Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Grp75 (646-679aa KLFEMAYKKMASEREGSGSSGTGEQKEDQKEEKQ), identical to the related mouse and rat sequences.
Calculated MW: 73680
Purification: Immunogen affinity purified.
Format: Lyophilized
Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
Protein Function:
Implicated in the control of cell proliferation and cellular aging. May also act as a chaperone. .
Other Names: Stress-70 protein, mitochondrial, 75 kDa glucose-regulated protein, GRP-75, Heat shock 70 kDa protein 9, Mortalin, MOT, Peptide-binding protein 74, PBP74, HSPA9, GRP75, HSPA9B, mt-HSP70
Subcellular Localization: Mitochondrion . Nucleus, nucleolus .
Gene ID: 3313
Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Grp75 (646-679aa KLFEMAYKKMASEREGSGSSGTGEQKEDQKEEKQ), identical to the related mouse and rat sequences.
Calculated MW: 73680
Purification: Immunogen affinity purified.
Format: Lyophilized
Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
| Is Featured? | No |
|---|
Write Your Own Review