Grp75 polyclonal, anti-human, mouse, rat
€384.00
In stock
SKU
ARP-10-P9642
Quantity: 100 µg
Background:
HSPA9 (heat shock 70kDa protein 9 (mortalin)), also known as GRP75, mot-2, mthsp75, PBP74, HSPA9B, MORTALIN or MORTALIN, PERINUCLEAR, is a highly conserved member of the HSP70 family of proteins. It functions as a chaperone in the mitochondria, cytoplasm, and centrosome. The HSPA9 gene is mapped to chromosome 5q31.2 based on an alignment of the HSPA9 sequence with the genomic sequence. Knockdown of HSPA9 in erythroid cultures was associated with an increased number of cells in the G0/G1 phase of the cell cycle and accelerated apoptosis. Knockdown of Hspa9 in mouse bone marrow cells, followed by transplantation into wildtype recipients, also resulted in loss of erythroid cell number. Haploinsufficiency for HSPA9 may contribute to abnormal hematopoiesis in myelodysplastic syndromes. This protein plays a role in the control of cell proliferation.
Description:
Rabbit IgG polyclonal antibody for Stress-70 protein, mitochondrial (HSPA9) detection. Tested with WB, IHC-P in Human, Mouse, Rat.
Synonyms:
75 kDa glucose regulated protein antibody, 75 kDa glucose-regulated protein antibody, CSA antibody, Glucose Regulated Protein antibody, Grp 75 antibody, GRP-75 antibody, GRP75 antibody, GRP75_HUMAN antibody, Heat shock 70 kDa protein 9 antibody, Heat shock 70kD protein 9 antibody, heat shock 70kDa protein 9 antibody, Heat shock 70kDa protein 9B antibody, Heat shock protein 74 kDa A antibody, Heat shock protein A antibody, Heat shock protein cognate 74 antibody, Hsc74 antibody, Hsp74 antibody, Hsp74a antibody, HSPA9 antibody, Hspa9a antibody, HSPA9B antibody, MGC4500 antibody, mitochondrial antibody, Mortalin 2 antibody, Mortalin antibody, Mortalin perinuclear antibody, Mortalin2 antibody, MOT 2 antibody, MOT antibody, MOT2 antibody, Mthsp70 antibody, p66 mortalin antibody, P66 MOT antibody, PBP74 antibody, Peptide binding protein 74 antibody, Peptide-binding protein 74 antibody, Stress 70 protein mitochondrial antibody, Stress 70 protein mitochondrial precursor antibody, Stress-70 protein antibody.
Isotype: Rabbit polyclonal IgG
Immunogen:
A synthetic peptide corresponding to a sequence at the C-terminus of human Grp75 (646-679aa KLFEMAYKKMASEREGSGSSGTGEQKEDQKEEKQ), identical to the related mouse and rat sequences.
Form: Lyophilized; Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Specificity:
No cross reactivity with other proteins.
Reactivity: Reacts with: human, mouse, rat
Applications: WB, IHC-P
Reconstitution:
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.
| Is Featured? | No |
|---|
Write Your Own Review