GRP78 BiP polyclonal, anti-human, mouse, rat

Quantity: 100 µg

Background:
HSPA5 (heat shock 70kDa protein 5), also known as glucose-regulated protein, 78kD (GRP78) or BiP, is a member of the heat-shock protein-70 (HSP70) family and is involved in the folding and assembly of proteins in the endoplasmic reticulum. BiP is also an essential component of the translocation machinery, as well as playing a role in retrograde transport across the ER membrane of aberrant proteins destined for degradation by the proteasome. The HSPA5 gene is mapped on 9q33.3. Shen et al. (2002) concluded that HSPA5 retains ATF6 in the ER by inhibiting its Golgi localization signals and that dissociation of HSPA5 during ER stress allows ATF6 to be transported to the Golgi. The findings of Shen et al. (2002) demonstrated that HSPA5 is a key element in sensing the folding capacity within the ER.

Description:
Rabbit IgG polyclonal antibody for 78 kDa glucose-regulated protein (HSPA5) detection. Tested with WB, IHC-P in Human, Mouse, Rat.

Synonyms:
78 kDa glucose regulated protein antibody, 78 kDa glucose-regulated protein antibody, AL022860 antibody, AU019543 antibody, BIP antibody, D2Wsu141e antibody, D2Wsu17e antibody, Endoplasmic reticulum lumenal Ca(2+)-binding protein grp78 antibody, Endoplasmic reticulum lumenal Ca2+ binding protein grp78 antibody, FLJ26106 antibody, Glucose Regulated Protein 78kDa antibody, GRP 78 antibody, GRP-78 antibody, GRP78 antibody, GRP78_HUMAN antibody, Heat shock 70 kDa protein 5 antibody, Heat Shock 70kDa Protein 5 antibody, Hsce70 antibody, HSPA 5 antibody, HSPA5 antibody, Immunoglobulin Heavy Chain Binding Protein antibody, Immunoglobulin heavy chain-binding protein antibody, mBiP antibody, MIF2 antibody, Sez7 antibody.

Isotype: Rabbit polyclonal IgG

Immunogen:
A synthetic peptide corresponding to a sequence at the C-terminus of human GRP78 BiP (592-624aa ETMEKAVEEKIEWLESHQDADIEDFKAKKKELE), identical to the related mouse and rat sequences.

Form: Lyophilized; Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Specificity:
No cross reactivity with other proteins.

Reactivity: Reacts with: human, mouse, rat

Applications: WB, IHC-P

Reconstitution:
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.