GSK3 alpha Picoband polyclonal, anti-human, mouse, rat
€455.00
In stock
SKU
AC-ABO10279
Catalog Number: AC-ABO10279
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB
Datasheet
Request Information
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB
Datasheet
Request Information
Description: Rabbit IgG polyclonal antibody for GSK3 alpha detection. Tested with WB in Human;Mouse;Rat.
Protein Function:
Constitutively active protein kinase that acts as a negative regulator in the hormonal control of glucose homeostasis, Wnt signaling and regulation of transcription factors and microtubules, by phosphorylating and inactivating glycogen synthase (GYS1 or GYS2), CTNNB1/beta-catenin, APC and AXIN1. Requires primed phosphorylation of the majority of its substrates. Contributes to insulin regulation of glycogen synthesis by phosphorylating and inhibiting GYS1 activity and hence glycogen synthesis. Regulates glycogen metabolism in liver, but not in muscle. May also mediate the development of insulin resistance by regulating activation of transcription factors. In Wnt signaling, regulates the level and transcriptional activity of nuclear CTNNB1/beta-catenin. Facilitates amyloid precursor protein (APP) processing and the generation of APP-derived amyloid plaques found in Alzheimer disease. May be involved in the regulation of replication in pancreatic beta-cells. Is necessary for the establishment of neuronal polarity and axon outgrowth. Through phosphorylation of the anti-apoptotic protein MCL1, may control cell apoptosis in response to growth factors deprivation.
Other Names: Glycogen synthase kinase-3 alpha, GSK-3 alpha, 2.7.11.26, Serine/threonine-protein kinase GSK3A, 2.7.11.1, GSK3A
Gene ID: 2931
Immunogen: A synthetic peptide corresponding to a sequence of human GSK3 alpha (QEVAYTDIKVIGNGSFGVVYQARLAETRELVAIKKVLQDKR).
Calculated MW: 50981
Format: Lyophilized
Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Contents: Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Storage: At -20˚C; for one year. After reconstitution, at 4˚C; for one month. It can also be aliquotted and stored frozen at -20˚C; for a longer time. Avoid repeated freezing and thawing.
Protein Function:
Constitutively active protein kinase that acts as a negative regulator in the hormonal control of glucose homeostasis, Wnt signaling and regulation of transcription factors and microtubules, by phosphorylating and inactivating glycogen synthase (GYS1 or GYS2), CTNNB1/beta-catenin, APC and AXIN1. Requires primed phosphorylation of the majority of its substrates. Contributes to insulin regulation of glycogen synthesis by phosphorylating and inhibiting GYS1 activity and hence glycogen synthesis. Regulates glycogen metabolism in liver, but not in muscle. May also mediate the development of insulin resistance by regulating activation of transcription factors. In Wnt signaling, regulates the level and transcriptional activity of nuclear CTNNB1/beta-catenin. Facilitates amyloid precursor protein (APP) processing and the generation of APP-derived amyloid plaques found in Alzheimer disease. May be involved in the regulation of replication in pancreatic beta-cells. Is necessary for the establishment of neuronal polarity and axon outgrowth. Through phosphorylation of the anti-apoptotic protein MCL1, may control cell apoptosis in response to growth factors deprivation.
Other Names: Glycogen synthase kinase-3 alpha, GSK-3 alpha, 2.7.11.26, Serine/threonine-protein kinase GSK3A, 2.7.11.1, GSK3A
Gene ID: 2931
Immunogen: A synthetic peptide corresponding to a sequence of human GSK3 alpha (QEVAYTDIKVIGNGSFGVVYQARLAETRELVAIKKVLQDKR).
Calculated MW: 50981
Format: Lyophilized
Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Contents: Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Storage: At -20˚C; for one year. After reconstitution, at 4˚C; for one month. It can also be aliquotted and stored frozen at -20˚C; for a longer time. Avoid repeated freezing and thawing.
| Is Featured? | No |
|---|
Write Your Own Review