GSTA1/A2/A3/A4/A5 Picoband polyclonal, anti-human, mouse, rat

GSTA1/A2/A3/A4/A5 Picoband polyclonal, anti-human, mouse, rat

€455.00
In stock
SKU
AC-ABO12313
Catalog Number: AC-ABO12313
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB
Datasheet
Request Information
Description: Rabbit IgG polyclonal antibody for Glutathione S-transferase A1/A2/A3/A4/A5(GSTA1/A2/A3/A4/A5) detection. Tested with WB in Human; Mouse;Rat.Protein Name: Glutathione S-transferase A1/A2/A3/A4/A5

Protein Function:
GSTA1: Conjugation of reduced glutathione to a wide number ofexogenous and endogenous hydrophobic electrophiles.|GSTA2: Conjugation of reduced glutathione to a wide number ofexogenous and endogenous hydrophobic electrophiles.|GSTA3: Conjugation of reduced glutathione to a wide number ofexogenous and endogenous hydrophobic electrophiles. Catalyzesisomerization reactions that contribute to the biosynthesis ofsteroid hormones. Efficiently catalyze obligatory double-bondisomerizations of delta(5)-androstene-3,17-dione and delta(5)-pregnene-3,20-dione, precursors to testosterone and progesterone,respectively. |GSTA4: Conjugation of reduced glutathione to a wide number ofexogenous and endogenous hydrophobic electrophiles. This isozymehas a high catalytic efficiency with 4-hydroxyalkenals such as 4-hydroxynonenal (4-HNE).

Other Names: Glutathione S-transferase A5, 2.5.1.18, GST class-alpha member 5, Glutathione S-transferase A5-5, GSTA5

Subcellular Localization: Cytoplasm .

Tissue Specificity: Expression not detected.

Gene ID: 221357

Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human GSTA1/A2/A3/A4/A5 (63-97aa MKLVQTRAILNYIASKYNLYGKDIKERALIDM YIE), different from the related mouse and rat sequences by five amino acids.

Calculated MW: 25722

Purification: Immunogen affinity purified.

Format: Lyophilized

Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
More Information
Is Featured? No
Write Your Own Review
You're reviewing:GSTA1/A2/A3/A4/A5 Picoband polyclonal, anti-human, mouse, rat