GSTA1/A2/A3/A4/A5 polyclonal, anti-human, mouse, rat

Quantity: 100 µg

Background:
Cytosolic and membrane-bound forms of glutathione S-transferase are encoded by two distinct supergene families. These enzymes function in the detoxification of electrophilic compounds, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress, by conjugation with glutathione. The genes encoding these enzymes are known to be highly polymorphic. These genetic variations can change an individual's susceptibility to carcinogens and toxins as well as affect the toxicity and efficacy of some drugs. At present, eight distinct classes of the soluble cytoplasmic mammalian glutathione S-transferases have been identified: alpha, kappa, mu, omega, pi, sigma, theta and zeta. This gene encodes a glutathione S-transferase belonging to the alpha class. The alpha class genes, located in a cluster mapped to chromosome 6, are the most abundantly expressed glutathione S-transferases in liver (hepatocytes) and kidney (proximal tubules). In addition to metabolizing bilirubin and certain anti-cancer drugs in the liver, the alpha class of these enzymes exhibit glutathione peroxidase activity, thereby protecting the cells from reactive oxygen species and the products of peroxidation.

Description:
Rabbit IgG polyclonal antibody for Glutathione S-transferase A1/A2/A3/A4/A5 (GSTA1/A2/A3/A4/A5) detection. Tested with WB in Human, Mouse, Rat.

Synonyms:
GST 2 antibody, GST class alpha antibody, GST class alpha 1 antibody, GST class alpha member 1 antibody, GST epsilon antibody, GST HA subunit 1 antibody, GST, class alpha, 1 antibody, GST-epsilon antibody, GST2 antibody, GSTA 1 antibody, GSTA1 1 antibody, GSTA1 antibody, GSTA1 protein antibody, GSTA1-1 antibody, GSTA1_HUMAN antibody, GTH 1 antibody, GTH1 antibody, HA subunit 1 antibody, MGC131939 antibody, EC 2.5.1.18 antibody, GST 1b-1b antibody, GST A2-2 antibody, GST class alpha member 2 antibody, GST gamma antibody, GST HA subunit 2 antibody, GST Ya2 antibody, GST, class alpha, 2 antibody, GST2 antibody, Gst2-2 antibody, GSTA2 2 antibody, GSTA2-2 antibody, Gstc-2 antibody, Gstc2 antibody, GTA2 antibody, GTH2 antibody, HA subunit 2 antibody, Liver GST2 antibody, MGC10525 antibody, GST 2 2 antibody, GST AA antibody, GST class alpha antibody, GST class alpha member 3 antibody, GST Yc1 antibody, GSTA 3 antibody, GSTA3 3 antibody, Gsta3 antibody, GSTA3-3 antibody, GSTA3_HUMAN antibody, Gstyc antibody, GTA 3 antibody, GTA3 antibody, Yc1 antibody, GSTA4 4 antibody, GSTA4 antibody, GSTA4_HUMAN antibody, GTA4 antibody, GST A5 5 antibody, GST class-alpha member 5 antibody, GST Yc2 antibody, GSTA5 antibody, GSTA5_HUMAN antibody

Isotype: Rabbit polyclonal IgG

Immunogen:
A synthetic peptide corresponding to a sequence at the N-terminus of human GSTA1/A2/A3/A4/A5 (63-97aa MKLVQTRAILNYIASKYNLYGKDIKERALIDM YIE), different from the related mouse and rat sequences by five amino acids.A synthetic peptide corresponding to a sequence at the N-terminus of human GSTA1/A2/A3/A4/A5 (63-97aa MKLVQTRAILNYIASKYNLYGKDIKERALIDM YIE), different from the related mouse and rat sequences by five amino acids.

Form: Lyophilized; Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Specificity:
No cross reactivity with other proteins.

Reactivity: Reacts with: mouse, rat.
Predicted to work with: human.

Applications: WB

Reconstitution:
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.