GSTM1 Picoband polyclonal, anti-mouse, rat
€455.00
In stock
SKU
AC-ABO12860
Catalog Number: AC-ABO12860
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB
Datasheet
Request Information
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB
Datasheet
Request Information
Description: Rabbit IgG polyclonal antibody for GSTM1 detection. Tested with WB in Human;Mouse;Rat.
Protein Function:
Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles.
Other Names: Glutathione S-transferase Mu 1, 2.5.1.18, GST HB subunit 4, GST class-mu 1, GSTM1-1, GSTM1a-1a, GSTM1b-1b, GTH4, GSTM1, GST1
Subcellular Localization: Cytoplasm.
Tissue Specificity: Liver (at protein level).
Gene ID: 2944
Immunogen: A synthetic peptide corresponding to a sequence of human GSTM1 (EEEKIRVDILENQTMDNHMQLGMICYNPEFEKLK).
Calculated MW: 25712
Format: Lyophilized
Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Contents: Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Storage: At -20˚C; for one year. After reconstitution, at 4˚C; for one month. It can also be aliquotted and stored frozen at -20˚C; for a longer time. Avoid repeated freezing and thawing.
Protein Function:
Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles.
Other Names: Glutathione S-transferase Mu 1, 2.5.1.18, GST HB subunit 4, GST class-mu 1, GSTM1-1, GSTM1a-1a, GSTM1b-1b, GTH4, GSTM1, GST1
Subcellular Localization: Cytoplasm.
Tissue Specificity: Liver (at protein level).
Gene ID: 2944
Immunogen: A synthetic peptide corresponding to a sequence of human GSTM1 (EEEKIRVDILENQTMDNHMQLGMICYNPEFEKLK).
Calculated MW: 25712
Format: Lyophilized
Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Contents: Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Storage: At -20˚C; for one year. After reconstitution, at 4˚C; for one month. It can also be aliquotted and stored frozen at -20˚C; for a longer time. Avoid repeated freezing and thawing.
| Is Featured? | No |
|---|
Write Your Own Review