GSTM1 Picoband polyclonal, anti-mouse, rat

GSTM1 Picoband polyclonal, anti-mouse, rat

€455.00
In stock
SKU
AC-ABO12860
Catalog Number: AC-ABO12860
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB
Datasheet
Request Information
Description: Rabbit IgG polyclonal antibody for GSTM1 detection. Tested with WB in Human;Mouse;Rat.

Protein Function:
Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles.

Other Names: Glutathione S-transferase Mu 1, 2.5.1.18, GST HB subunit 4, GST class-mu 1, GSTM1-1, GSTM1a-1a, GSTM1b-1b, GTH4, GSTM1, GST1

Subcellular Localization: Cytoplasm.

Tissue Specificity: Liver (at protein level).

Gene ID: 2944

Immunogen: A synthetic peptide corresponding to a sequence of human GSTM1 (EEEKIRVDILENQTMDNHMQLGMICYNPEFEKLK).

Calculated MW: 25712

Format: Lyophilized

Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Contents: Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Storage: At -20˚C; for one year. After reconstitution, at 4˚C; for one month. It can also be aliquotted and stored frozen at -20˚C; for a longer time. Avoid repeated freezing and thawing.
More Information
Is Featured? No
Write Your Own Review
You're reviewing:GSTM1 Picoband polyclonal, anti-mouse, rat