GTPase HRAS polyclonal, anti-human, mouse, rat

GTPase HRAS polyclonal, anti-human, mouse, rat

€455.00
In stock
SKU
AC-ABO12775
Catalog Number: AC-ABO12775
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB
Datasheet
Request Information
Description: Rabbit IgG polyclonal antibody for GTPase Hras(HRAS) detection. Tested with WB in Human;Mouse;Rat.Protein Name: GTPase Hras

Protein Function:
Ras proteins bind GDP/GTP and possess intrinsic GTPase activity. .

Other Names: GTPase HRas, H-Ras-1, Ha-Ras, Transforming protein p21, c-H-ras, p21ras, GTPase HRas, N-terminally processed, HRAS, HRAS1

Subcellular Localization: Cell membrane. Cell membrane; Lipid-anchor; Cytoplasmic side. Golgi apparatus. Golgi apparatus membrane; Lipid-anchor. The active GTP-bound form is localized most strongly to membranes than the inactive GDP-bound form (By similarity). Shuttles between the plasma membrane and the Golgi apparatus. .

Tissue Specificity: Widely expressed. .

Gene ID: 3265

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human GTPase HRAS (101-137aa KRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLAR SY), identical to the related mouse and rat sequences.

Calculated MW: 21298

Purification: Immunogen affinity purified.

Format: Lyophilized

Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
More Information
Is Featured? No
Write Your Own Review
You're reviewing:GTPase HRAS polyclonal, anti-human, mouse, rat