GTPase HRAS polyclonal, anti-human, mouse, rat
€354.00
In stock
SKU
ARP-10-R1099
Quantity: 100 µg
Background:
GTPase HRas, also known as transforming protein p21, is an enzyme that in humans is encoded by the HRAS gene. This gene belongs to the Ras oncogene family, whose members are related to the transforming genes of mammalian sarcoma retroviruses. The products encoded by these genes function in signal transduction pathways. These proteins can bind GTP and GDP, and they have intrinsic GTPase activity. This protein undergoes a continuous cycle of de- and re-palmitoylation, which regulates its rapid exchange between the plasma membrane and the Golgi apparatus. Mutations in this gene cause Costello syndrome, a disease characterized by increased growth at the prenatal stage, growth deficiency at the postnatal stage, predisposition to tumor formation, mental retardation, skin and musculoskeletal abnormalities, distinctive facial appearance and cardiovascular abnormalities. Defects in this gene are implicated in a variety of cancers, including bladder cancer, follicular thyroid cancer, and oral squamous cell carcinoma. Multiple transcript variants, which encode different isoforms, have been identified for this gene.
Description:
Rabbit IgG polyclonal antibody for GTPase Hras (HRAS) detection. Tested with WB in Human, Mouse, Rat.
Synonyms:
C BAS/HAS antibody, c H ras antibody, C HA RAS1 antibody, c has/bas p21 protein antibody, c ras Ki 2 activated oncogene antibody, c-H-ras antibody, CTLO antibody, GTP and GDP binding peptide B antibody, GTPase HRas, N-terminally processed antibody, H Ras 1 antibody, H RASIDX antibody, H-Ras-1 antibody, Ha Ras antibody, Ha Ras1 proto oncoprotein antibody, Ha-Ras antibody, HAMSV antibody, Harvey rat sarcoma viral oncogene homolog antibody, Harvey rat sarcoma viral oncoprotein antibody, HRAS antibody, HRAS1 antibody, K ras antibody, N ras antibody, p19 H RasIDX protein antibody, p21ras antibody, Ras family small GTP binding protein H Ras antibody, RASH_HUMAN antibody, RASH1 antibody, Transformation gene oncogene HAMSV antibody, Transforming protein p21 antibody, v Ha ras Harvey rat sarcoma viral oncogene homolog antibody, VH Ras antibody, vHa RAS antibody
Isotype: Rabbit polyclonal IgG
Immunogen:
A synthetic peptide corresponding to a sequence at the C-terminus of human GTPase HRAS (101-137aa KRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLAR SY), identical to the related mouse and rat sequences.A synthetic peptide corresponding to a sequence at the C-terminus of human GTPase HRAS (101-137aa KRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLAR SY), identical to the related mouse and rat sequences.
Form: Lyophilized; Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Specificity:
No cross reactivity with other proteins.
Reactivity: Reacts with: mouse, rat.
Predicted to work with: human.
Applications: WB
Reconstitution:
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.
| Is Featured? | No |
|---|
Write Your Own Review