Haptoglobin polyclonal, anti-human, mouse
€384.00
In stock
SKU
ARP-10-P9219
Quantity: 100 µg
Background:
Haptoglobin(HP), is a protein that in humans is encoded by the HP gene. Haptoglobin, a plasma glycoprotein that binds free hemoglobin, has a tetrameric structure of 2 alpha and 2 beta polypeptides that are covalently associated by disulfide bonds. Haptoglobin is homologous to serine proteases of the chymotrypsinogen family. A major function of haptoglobin is to bind hemoglobin(Hb) to form a stable Hp-Hb complex and thereby prevent Hb-induced oxidative tissue damage. Haptoglobin is an unusual secretory protein in that it is proteolytically processed in the endoplasmic reticulum and not in the Golgi. In clinical settings, the haptoglobulin assay is used to screen for and monitor intravascular hemolytic anemia.
Description:
Rabbit IgG polyclonal antibody for Haptoglobin (HP) detection. Tested with WB, IHC-P in Human, Mouse.
Synonyms:
Binding peptide antibody, Bp antibody, Haptoglobin alpha chain antibody, Haptoglobin alpha(1S) beta antibody, Haptoglobin alpha(2FS) beta antibody, Haptoglobin beta chain antibody, Haptoglobin, alpha polypeptide antibody, Haptoglobin, beta polypeptide antibody, HP antibody, Hp2 alpha antibody, HP2 ALPHA2 antibody, HP2ALPHA2 antibody, HPA1S antibody, HPT antibody, HPT_HUMAN antibody, MGC111141 antibody, Zonulin antibody
Isotype: Rabbit polyclonal IgG
Immunogen:
A synthetic peptide corresponding to a sequence in the middle region of human Haptoglobin(128-160aa NNEKQWINKAVGDKLPECEAVCGKPKNPANPVQ), different from the related mouse sequence by ten amino acids, and from the related rat sequence by nine amino acids.
Form: Lyophilized; Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Specificity:
No cross reactivity with other proteins.
Reactivity: Reacts with: human, mouse
Applications: WB, IHC-P
Reconstitution:
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.
| Is Featured? | No |
|---|
Write Your Own Review