HCN2 Picoband polyclonal, anti-human, mouse, rat
€455.00
In stock
SKU
AC-ABO10260
Catalog Number: AC-ABO10260
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB, IHC-P
Datasheet
Request Information
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB, IHC-P
Datasheet
Request Information
Description: Rabbit IgG polyclonal antibody for Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 2(HCN2) detection. Tested with WB, IHC-P in Human;Mouse;Rat.Protein Name: Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 2
Protein Function:
Hyperpolarization-activated ion channel exhibiting weak selectivity for potassium over sodium ions. Contributes to the native pacemaker currents in heart (If) and in neurons (Ih). Can also transport ammonium in the distal nephron. Produces a large instantaneous current. Modulated by intracellular chloride ions and pH; acidic pH shifts the activation to more negative voltages (By similarity). .
Other Names: Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 2, Brain cyclic nucleotide-gated channel 2, BCNG-2, HCN2, BCNG2
Subcellular Localization: Cell membrane ; Multi-pass membrane protein .
Tissue Specificity: Highly expressed throughout the brain. Detected at low levels in heart. .
Gene ID: 610
Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human HCN2 (682-714aa VFNNQENAIIQEIVKYDREMVQQAELGQRVGLF), identical to the related mouse sequence, and different from the related rat sequence by one amino acid.
Calculated MW: 96950
Purification: Immunogen affinity purified.
Format: Lyophilized
Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
Protein Function:
Hyperpolarization-activated ion channel exhibiting weak selectivity for potassium over sodium ions. Contributes to the native pacemaker currents in heart (If) and in neurons (Ih). Can also transport ammonium in the distal nephron. Produces a large instantaneous current. Modulated by intracellular chloride ions and pH; acidic pH shifts the activation to more negative voltages (By similarity). .
Other Names: Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 2, Brain cyclic nucleotide-gated channel 2, BCNG-2, HCN2, BCNG2
Subcellular Localization: Cell membrane ; Multi-pass membrane protein .
Tissue Specificity: Highly expressed throughout the brain. Detected at low levels in heart. .
Gene ID: 610
Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human HCN2 (682-714aa VFNNQENAIIQEIVKYDREMVQQAELGQRVGLF), identical to the related mouse sequence, and different from the related rat sequence by one amino acid.
Calculated MW: 96950
Purification: Immunogen affinity purified.
Format: Lyophilized
Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
| Is Featured? | No |
|---|
Write Your Own Review