HDAC6 polyclonal, anti-human, rat

Quantity: 100 µg

Background:
HDAC6, also called KIAA0901, is a member belongs to class II of the histone deacetylase/acuc/apha family of proteins that is an enzyme that in humans is encoded by the HDAC6 gene. The HDAC6 gene is mapped to chromosome Xp11.23. HDAC6 contains an internal duplication of two catalytic domains which appear to function independently of each other. The protein possesses histone deacetylase activity and represses transcription. HDAC6 functions as a tubulin deacetylase. And it is localized exclusively in the cytoplasm, where it associates with microtubules and localizes with the microtubule motor complex. HDAC6 could bind both polyubiquitinated misfolded proteins and dynein motors, thereby recruiting misfolded protein cargo to dynein motors for transport to aggresomes. Furthermore, expression of HDAC6 was sufficient to rescue degeneration associated with UPS dysfunction in vivo in an autophagy-dependent manner. HDAC6 is a central component of the stress response that regulates SG formation and potentially contributes to control of RNA metabolism and translation.

Description:
Rabbit IgG polyclonal antibody for Histone deacetylase 6 (HDAC6) detection. Tested with WB in Human, Rat.

Synonyms:
FLJ16239 antibody, HD 6 antibody, HD6 antibody, HDAC 6 antibody, HDAC6 antibody, HDAC6_HUMAN antibody, Histone deacetylase 6 (HD6) antibody, Histone deacetylase 6 antibody, JM 21 antibody, JM21 antibody, KIAA0901 antibody, OTTHUMP00000032398 antibody, OTTHUMP00000197663 antibody.

Isotype: Rabbit polyclonal IgG

Immunogen:
A synthetic peptide corresponding to a sequence at the N-terminus of human HDAC6 (137-169aa EKEELMLVHSLEYIDLMETTQYMNEGELRVLAD), different from the related mouse sequence by one amino acid.A synthetic peptide corresponding to a sequence at the N-terminus of human HDAC6 (137-169aa EKEELMLVHSLEYIDLMETTQYMNEGELRVLAD), different from the related mouse sequence by one amino acid.

Form: Lyophilized; Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Specificity:
No cross reactivity with other proteins.

Reactivity: Reacts with: human, rat

Applications: WB

Reconstitution:
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.