HDGF Picoband polyclonal, anti-human, mouse, rat

HDGF Picoband polyclonal, anti-human, mouse, rat

€455.00
In stock
SKU
AC-ABO10143
Catalog Number: AC-ABO10143
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB, IHC-P
Datasheet
Request Information
Description: Rabbit IgG polyclonal antibody for Hepatoma-derived growth factor(HDGF) detection. Tested with WB, IHC-P in Human;Mouse;Rat.Protein Name: Hepatoma-derived growth factor

Protein Function:
Heparin-binding protein, with mitogenic activity for fibroblasts. Acts as a transcriptional repressor. .

Other Names: Hepatoma-derived growth factor, HDGF, High mobility group protein 1-like 2, HMG-1L2, HDGF, HMG1L2

Subcellular Localization: Cytoplasm. Nucleus.

Tissue Specificity: Ubiquitous.

Gene ID: 3068

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human HDGF (61-97aa KDLFPYEESKEKFGKPNKRKGFSEGLWEIENNPTVKA), identical to the related mouse and rat sequences.

Calculated MW: 26788

Purification: Immunogen affinity purified.

Format: Lyophilized

Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
More Information
Is Featured? No
Write Your Own Review
You're reviewing:HDGF Picoband polyclonal, anti-human, mouse, rat