HDGF Picoband polyclonal, anti-human, mouse, rat
€455.00
In stock
SKU
AC-ABO10143
Catalog Number: AC-ABO10143
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB, IHC-P
Datasheet
Request Information
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB, IHC-P
Datasheet
Request Information
Description: Rabbit IgG polyclonal antibody for Hepatoma-derived growth factor(HDGF) detection. Tested with WB, IHC-P in Human;Mouse;Rat.Protein Name: Hepatoma-derived growth factor
Protein Function:
Heparin-binding protein, with mitogenic activity for fibroblasts. Acts as a transcriptional repressor. .
Other Names: Hepatoma-derived growth factor, HDGF, High mobility group protein 1-like 2, HMG-1L2, HDGF, HMG1L2
Subcellular Localization: Cytoplasm. Nucleus.
Tissue Specificity: Ubiquitous.
Gene ID: 3068
Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human HDGF (61-97aa KDLFPYEESKEKFGKPNKRKGFSEGLWEIENNPTVKA), identical to the related mouse and rat sequences.
Calculated MW: 26788
Purification: Immunogen affinity purified.
Format: Lyophilized
Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
Protein Function:
Heparin-binding protein, with mitogenic activity for fibroblasts. Acts as a transcriptional repressor. .
Other Names: Hepatoma-derived growth factor, HDGF, High mobility group protein 1-like 2, HMG-1L2, HDGF, HMG1L2
Subcellular Localization: Cytoplasm. Nucleus.
Tissue Specificity: Ubiquitous.
Gene ID: 3068
Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human HDGF (61-97aa KDLFPYEESKEKFGKPNKRKGFSEGLWEIENNPTVKA), identical to the related mouse and rat sequences.
Calculated MW: 26788
Purification: Immunogen affinity purified.
Format: Lyophilized
Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
| Is Featured? | No |
|---|
Write Your Own Review