Heparanase 1 polyclonal, anti-human, rat
€384.00
In stock
SKU
ARP-10-P9427
Quantity: 100 µg
Background:
Heparanase, also known as HPSE, is an enzyme that acts both at the cell-surface and within the extracellular matrix to degrade polymeric heparan sulfate molecules into shorter chain length oligosaccharides. Heparanase is an endo-beta-D-glucuronidase capable of cleaving heparan sulfate and has been implicated in inflammation and tumor angiogenesis and metastasis. The successful penetration of the endothelial cell layer that lines the interior surface of blood vessels is an important process in the formation of blood borne tumour metastases. Heparan sulfate proteoglycans are major constituents of this layer and it has been shown that increased metastatic potential corresponds with increased heparanase activity for a number of cell lines.
Description:
Rabbit IgG polyclonal antibody for Heparanase (HPSE) detection. Tested with WB in Human, Rat.
Synonyms:
Endo glucoronidase antibody, Endo-glucoronidase antibody, HEP antibody, Heparanase 50 kDa subunit antibody, Heparanase antibody, Heparanase-1 antibody, Heparanase1 antibody, Hpa 1 antibody, HPA antibody, Hpa1 antibody, HPR 1 antibody, HPR1 antibody, HPSE 1 antibody, HPSE antibody, HPSE_HUMAN antibody, HPSE1 antibody, HSE 1 antibody, HSE1 antibody.
Isotype: Rabbit polyclonal IgG
Immunogen:
A synthetic peptide corresponding to a sequence in the middle region of human Heparanase 1 (301-331aa NGRTATKEDFLNPDVLDIFISSVQKVFQVVE), different from the related mouse and rat sequences by eight amino acids.A synthetic peptide corresponding to a sequence in the middle region of human Heparanase 1 (301-331aa NGRTATKEDFLNPDVLDIFISSVQKVFQVVE), different from the related mouse and rat sequences by eight amino acids.
Form: Lyophilized; Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Specificity:
No cross reactivity with other proteins.
Reactivity: Reacts with: human, rat
Applications: WB
Reconstitution:
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.
| Is Featured? | No |
|---|
Write Your Own Review