Hex Picoband polyclonal, anti-human, mouse, rat

Hex Picoband polyclonal, anti-human, mouse, rat

€455.00
In stock
SKU
AC-ABO12317
Catalog Number: AC-ABO12317
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB
Datasheet
Request Information
Description: Rabbit IgG polyclonal antibody for Hematopoietically-expressed homeobox protein Hhex(HHEX) detection. Tested with WB in Human;Mouse; Rat. Protein Name: Hematopoietically-expressed homeobox protein Hhex

Protein Function:
Recognizes the DNA sequence 5'-ATTAA-3'. Transcriptional repressor. May play a role in hematopoietic differentiation. Establishes anterior identity at two levels; acts early to enhance canonical WNT-signaling by repressing expression of TLE4, and acts later to inhibit NODAL-signaling by directly targeting NODAL (By similarity). .

Other Names: Hematopoietically-expressed homeobox protein HHEX, Homeobox protein HEX, Homeobox protein PRH, HHEX, HEX, PRH, PRHX

Subcellular Localization: Nucleus .

Tissue Specificity: Liver and promyelocytic leukemia cell line HL- 60. .

Gene ID: 3087

Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human Hex(146-180aa NDQTIELEKKFETQKYLSPPERKRLAKMLQLSERQ), different from the related mouse sequence by one amino acid.

Calculated MW: 30022

Purification: Immunogen affinity purified.

Format: Lyophilized

Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
More Information
Is Featured? No
Write Your Own Review
You're reviewing:Hex Picoband polyclonal, anti-human, mouse, rat