Hex polyclonal, anti-human, mouse, rat

Quantity: 100 µg

Background:
Hematopoietically-expressed homeobox protein HHEX is a protein that in humans is encoded by the HHEX gene. Homeobox genes are members of a family of transcription factors that regulate tissue development in many different organisms. Hromas et al. (1993) set out to identify homeobox genes that might play a role in hematopoiesis. And using somatic cell hybrid analysis, they mapped the HHEX gene to chromosome 10, where the HOX11 gene is located. Homeobox genes are involved in neoplastic transformation of both epithelial and hemopoietic tissues. The divergent homeobox gene HEX is expressed in the anterior visceral endoderm during early mouse development and in some adult tissues of endodermal origin, including liver and thyroid. D'Elia et al.’s findings suggested that regulation of HEX entry in the nucleus of thyrocytes may represent a critical step during human thyroid tumorigenesis.

Description:
Rabbit IgG polyclonal antibody for Hematopoietically-expressed homeobox protein Hhex (HHEX) detection. Tested with WB in Human, Mouse, Rat.

Synonyms:
Hematopoietically expressed homeobox antibody, Hematopoietically-expressed homeobox protein HHEX antibody, HEX antibody, HHEX antibody, HHEX_HUMAN antibody, HMPH antibody, Homeobox hematopoietically expressed antibody, Homeobox protein HEX antibody, Homeobox protein PRH antibody, HOX11L PEN antibody, PRH antibody, PRHX antibody, Proline rich homeodomain containing transcription factor antibody, OTTHUMP00000206478 antibody, OTTHUMP00000206479 antibody, OTTHUMP00000206480 antibody, OTTHUMP00000206482 antibody, OTTHUMP00000207360 antibody, USURPIN antibody, Usurpin beta antibody

Isotype: Rabbit polyclonal IgG

Immunogen:
A synthetic peptide corresponding to a sequence in the middle region of human Hex(146-180aa NDQTIELEKKFETQKYLSPPERKRLAKMLQLSERQ), different from the related mouse sequence by one amino acid.

Form: Lyophilized; Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Specificity:
No cross reactivity with other proteins.

Reactivity: Reacts with: human, mouse, rat

Applications: WB

Reconstitution:
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.