Hexokinase II Picoband polyclonal, anti-human, mouse, rat

Hexokinase II Picoband polyclonal, anti-human, mouse, rat

€455.00
In stock
SKU
AC-ABO10181
Catalog Number: AC-ABO10181
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB
Datasheet
Request Information
Description: Rabbit IgG polyclonal antibody for Hexokinase-2 (HK2) detection. Tested with WB in Human;Mouse;Rat.Protein Name: Hexokinase-2

Other Names: Hexokinase-2, 2.7.1.1, Hexokinase type II, HK II, Muscle form hexokinase, HK2

Subcellular Localization: Mitochondrion outer membrane . Its hydrophobic N-terminal sequence may be involved in membrane binding. .

Tissue Specificity: Predominant hexokinase isozyme expressed in insulin-responsive tissues such as skeletal muscle.

Gene ID: 3099

Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human Hexokinase II (460-497aa AYRLADQHRARQKTLEHLQLSHDQLLEVKRRMKVEMER), different from the related mouse and rat sequences by four amino acids.

Calculated MW: 102380

Purification: Immunogen affinity purified.

Format: Lyophilized

Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
More Information
Is Featured? No
Write Your Own Review
You're reviewing:Hexokinase II Picoband polyclonal, anti-human, mouse, rat