HIF-1-alpha polyclonal, anti-human, mouse, rat

HIF-1-alpha polyclonal, anti-human, mouse, rat

€384.00
In stock
SKU
ARP-10-P9253
Catalog Number: 10-P9253
Isotype: rabbit polyclonal IgG

Information
Questions? Contact us!


Quantity: 100 µg

Background:
HIF-1α (Hypoxia-inducible factor 1α, HIF1A) is a transcription factor that mediates cellular and systemic homeostatic responses to reduced O2 availability in mammals, including angiogenesis, erythropoiesis and glycolysis. This gene was mapped to 14q21-q24. HIF-1α transactivate genes required for energy metabolism and tissue perfusion and is necessary for embryonic development and tumor explant growth. HIF-1alpha is over expressed during carcinogenesis, myocardial infarction and wound healing. It is crucial for the cellular response to hypoxia and is frequently over expressed in human cancers, resulting in the activation of genes essential for cell survival. HIF-1α regulates the survival and function in the inflammatory microenvironment directly. It is a transcription factor that plays a pivotal role in cellular adaptation to changes in oxygen availability.

Description:
Rabbit IgG polyclonal antibody for Hypoxia-inducible factor 1-alpha (HIF1A) detection. Tested with WB, IHC-P in Human, Mouse, Rat.

Synonyms:
ARNT interacting protein antibody, ARNT-interacting protein antibody, Basic helix loop helix PAS protein MOP1 antibody, Basic-helix-loop-helix-PAS protein MOP1 antibody, bHLHe78 antibody, Class E basic helix-loop-helix protein 78 antibody, HIF 1A antibody, HIF 1alpha antibody, HIF-1-alpha antibody, HIF1 A antibody, HIF1 Alpha antibody, HIF1 antibody, HIF1-alpha antibody, HIF1A antibody, HIF1A_HUMAN antibody, Hypoxia inducible factor 1 alpha antibody, Hypoxia inducible factor 1 alpha isoform I.3 antibody, Hypoxia inducible factor 1 alpha subunit antibody, Hypoxia inducible factor 1 alpha subunit basic helix loop helix transcription factor antibody, Hypoxia inducible factor 1, alpha subunit (basic helix loop helix transcription factor) antibody, Hypoxia inducible factor1alpha antibody, Hypoxia-inducible factor 1-alpha antibody, Member of PAS protein 1 antibody, Member of PAS superfamily 1 antibody, Member of the PAS Superfamily 1 antibody, MOP 1 antibody, MOP1 antibody, PAS domain-containing protein 8 antibody, PASD 8 antibody, PASD8 antibody

Isotype: Rabbit polyclonal IgG

Immunogen:
A synthetic peptide corresponding to a sequence at the C-terminal of human HIF-1-alpha (703-732aa EEELNPKILALQNAQRKRKMEHDGSLFQAV), different from the related mouse and rat sequences by three amino acids.

Form: Lyophilized; Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Specificity:
No cross reactivity with other proteins.

Reactivity: Reacts with: human, mouse, rat

Applications: WB, IHC-P

Reconstitution:
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.
More Information
Is Featured? No
Write Your Own Review
You're reviewing:HIF-1-alpha polyclonal, anti-human, mouse, rat