HIF-2-alpha polyclonal, anti-rat

HIF-2-alpha polyclonal, anti-rat

€354.00
In stock
SKU
ARP-10-P1129-1
Catalog Number: 10-P1129-1
Isotype: rabbit polyclonal IgG

Information
Questions? Contact us!


Quantity: 100 µg

Background:
HIF-2 alpha is also designated EPAS1 whose gene is mapped to 2p21-p16. The predicted mouse protein is 88% identical to human EPAS1. The human EPAS1 gene contains 15 exons and spans at least 120 kb. The positions of the introns within the genomic region encoding the N-terminal bHLH-PAS domains of EPAS1 and AHR are similar, suggesting that the 5-prime ends of the 2 genes may have arisen from a gene duplication event1. Moreover, the predicted protein shares 48% sequence identity with HIF1-alpha, a bHLH-PAS transcription factor that induces EPO gene expression in cultured cells in response to hypoxia. Like HIF1A, EPAS1 binds to and activates transcription from the HIF1A response element derived from the 3-prime flanking region of the EPO gene. EPAS1 is predominantly expressed in highly vascularized tissues of adult humans and in endothelial cells of the mouse adult and embryo. Furthermore, EPAS1 may represent an important regulator of vascularization, perhaps involving the regulation of endothelial cell gene expression in response to hypoxia2. HIF2A is expressed at relatively higher levels in villus sections of placenta and in lung samples compared with other tissues examined3. In addition, The variation in EPAS1 influences the relative contribution of aerobic and anaerobic metabolism and hence the maximum sustainable metabolic power for a given event duration4.

Description:
Rabbit IgG polyclonal antibody for Endothelial PAS domain-containing protein 1 (EPAS1) detection. Tested with WB, IHC-P in Rat.

Synonyms:
Basic helix loop helix PAS protein MOP2 antibody, Basic-helix-loop-helix-PAS protein MOP2 antibody, bHLHe73 antibody, Class E basic helix-loop-helix protein 73 antibody, ECYT4 antibody, Endothelial PAS domain containing protein 1 antibody, Endothelial pas domain protein 1 antibody, Endothelial PAS domain-containing protein 1 antibody, EPAS 1 antibody, EPAS-1 antibody, EPAS1 antibody, EPAS1_HUMAN antibody, HIF 1 alpha like factor antibody, HIF 2 alpha antibody, HIF-1-alpha-like factor antibody, HIF-2-alpha antibody, HIF2-alpha antibody, Hif2a antibody, HLF antibody, Hypoxia inducible factor 2 alpha antibody, Hypoxia inducible factor 2 alpha subunit antibody, Hypoxia-inducible factor 2-alpha antibody, Member of PAS protein 2 antibody, Member of pas superfamily 2 antibody, MOP 2 antibody, MOP2 antibody, PAS domain-containing protein 2 antibody, PASD2 antibody

Isotype: Rabbit polyclonal IgG

Immunogen:
A synthetic peptide corresponding to a sequence at N-terminus of rat HIF-2-alpha(202-240aa YNNCPPHSSLCGYKEPLLSCLIIMCEPIQHPSHMDIPLD).A synthetic peptide corresponding to a sequence at N-terminus of rat HIF-2-alpha(202-240aa YNNCPPHSSLCGYKEPLLSCLIIMCEPIQHPSHMDIPLD).

Form: Lyophilized; Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg Thimerosal, 0.05mg NaN3.

Specificity:
No cross reactivity with other proteins.

Reactivity: Reacts with: rat

Applications: WB, IHC-P

Reconstitution:
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.
More Information
Is Featured? No
Write Your Own Review
You're reviewing:HIF-2-alpha polyclonal, anti-rat