HKDC1 Picoband polyclonal, anti-human

HKDC1 Picoband polyclonal, anti-human

€455.00
In stock
SKU
AC-ABO12066
Catalog Number: AC-ABO12066
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB
Datasheet
Request Information
Description: Rabbit IgG polyclonal antibody for Putative hexokinase HKDC1(HKDC1) detection. Tested with WB in Human.Protein Name: Putative hexokinase HKDC1

Other Names: Putative hexokinase HKDC1, 2.7.1.1, Hexokinase domain-containing protein 1, HKDC1

Gene ID: 80201

Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human HKDC1(102-136aa KRHVQMESQFYPTPNEIIRGNGTELFEYVADCLAD), different from the related mouse sequence by four amino acids.

Calculated MW: 102545

Purification: Immunogen affinity purified.

Format: Lyophilized

Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
More Information
Is Featured? No
Write Your Own Review
You're reviewing:HKDC1 Picoband polyclonal, anti-human