HMG4 polyclonal, anti-human, mouse, rat

Quantity: 100 µg

Background:
High-mobility group protein B, also known as HMG4, is a protein that in humans is encoded by the HMGB3 gene. This gene encodes a member of a family of proteins containing one or more high mobility group DNA-binding motifs. The encoded protein plays an important role in maintaining stem cell populations, and may be aberrantly expressed in tumor cells. A mutation in this gene was associated with microphthalmia, syndromic 13. There are numerous pseudogenes of this gene on multiple chromosomes. Alternative splicing results in multiple transcript variants.

Description:
Rabbit IgG polyclonal antibody for High mobility group protein B3 (HMGB3) detection. Tested with WB, IHC-P in Human, Mouse, Rat.

Synonyms:
chromosomal protein, Nonhistone, HMG4 antibody, High mobility group (nonhistone chromosomal) protein 4 antibody, High mobility group box 3 antibody, High mobility group protein 2a antibody, High mobility group protein 4 antibody, High mobility group protein B3 antibody, High mobility group protein HMG4 antibody, HMG 4 antibody, HMG-2a antibody, HMG-4 antibody, HMG2A antibody, HMGB 3 antibody, HMGB3 antibody, HMGB3_HUMAN antibody, MGC90319 antibody, Non histone chromosomal protein antibody, Nonhistone chromosomal protein HMG4 antibody.

Isotype: Rabbit polyclonal IgG

Immunogen:
A synthetic peptide corresponding to a sequence at the N-terminus of human HMG4 (62-95aa EMAKADKVRYDREMKDYGPAKGGKKKKDPNAPKR), identical to the related mouse and rat sequences.

Form: Lyophilized; Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Specificity:
No cross reactivity with other proteins.

Reactivity: Reacts with: human, mouse, rat

Applications: WB, IHC-P

Reconstitution:
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.