HNF1 Beta Picoband polyclonal, anti-human, rat
€455.00
In stock
SKU
AC-ABO12283
Catalog Number: AC-ABO12283
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB
Datasheet
Request Information
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB
Datasheet
Request Information
Description: Rabbit IgG polyclonal antibody for Hepatocyte nuclear factor 1-beta(HNF1B) detection. Tested with WB in Human;Rat.
Protein Name: Hepatocyte nuclear factor 1-beta
Protein Function:
Transcription factor, probably binds to the inverted palindrome 5'-GTTAATNATTAAC-3'.
Other Names: Hepatocyte nuclear factor 1-beta, HNF-1-beta, HNF-1B, Homeoprotein LFB3, Transcription factor 2, TCF-2, Variant hepatic nuclear factor 1, vHNF1, HNF1B, TCF2
Subcellular Localization: Nucleus.
Gene ID: 6928
Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human HNF1 beta (496-525aa AQQPFMAAVTQLQNSHMYAHKQEPPQYSHT), identical to the related mouse and rat sequences.
Calculated MW: 61324
Purification: Immunogen affinity purified.
Format: Lyophilized
Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
Protein Name: Hepatocyte nuclear factor 1-beta
Protein Function:
Transcription factor, probably binds to the inverted palindrome 5'-GTTAATNATTAAC-3'.
Other Names: Hepatocyte nuclear factor 1-beta, HNF-1-beta, HNF-1B, Homeoprotein LFB3, Transcription factor 2, TCF-2, Variant hepatic nuclear factor 1, vHNF1, HNF1B, TCF2
Subcellular Localization: Nucleus.
Gene ID: 6928
Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human HNF1 beta (496-525aa AQQPFMAAVTQLQNSHMYAHKQEPPQYSHT), identical to the related mouse and rat sequences.
Calculated MW: 61324
Purification: Immunogen affinity purified.
Format: Lyophilized
Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
| Is Featured? | No |
|---|
Write Your Own Review