HNF1 beta polyclonal, anti-human, rat

HNF1 beta polyclonal, anti-human, rat

€384.00
In stock
SKU
ARP-10-P9597
Catalog Number: 10-P9597
Isotype: rabbit polyclonal IgG

Information
Questions? Contact us!


Quantity: 100 µg

Background:
HNF1 homeobox B (hepatocyte nuclear factor 1 homeobox B), also known as HNF1B or transcription factor 2 (TCF2), is a human gene. It is a member of the homeodomain-containing superfamily of transcription factors. This gene is mapped to 17q12. The HNF1B protein is believed to form heterodimers with another liver-specific member of this transcription factor family, TCF1. HNF1B functions as both a classic transcriptional activator and as a bookmarking factor that marks target genes for rapid transcriptional reactivation after mitosis. HNF1B also can regulate renal tubulogenesis by controlling expression of SOC3. Mutation of HNF1B that disrupts normal function has been identified as the cause of MODY5 (Maturity-Onset of Diabetes, Type 5).

Description:
Rabbit IgG polyclonal antibody for Hepatocyte nuclear factor 1-beta (HNF1B) detection. Tested with WB in Human, Rat.

Synonyms:
FJHN antibody, Hepatocyte nuclear factor 1 beta antibody, Hepatocyte nuclear factor 1-beta antibody, HNF 1B antibody, HNF 2 antibody, HNF-1-beta antibody, HNF-1B antibody, HNF1 beta antibody, HNF1 homeobox B antibody, HNF1B antibody, HNF1beta antibody, HNF2 antibody, Homeoprotein LF B3 antibody, Homeoprotein LFB3 antibody, HPC11 antibody, LF B3 antibody, LFB3 antibody, MODY 5 antibody, MODY5 antibody, TCF 2 antibody, TCF 2 protein antibody, TCF-2 antibody, TCF2 antibody, TCF2 protein antibody, Transcription factor 2 antibody, Transcription factor 2 hepatic antibody, Variant hepatic nuclear factor 1 antibody, Variant hepatic nuclear factor antibody, VHNF 1 antibody, vHNF1 antibody

Isotype: Rabbit polyclonal IgG

Immunogen:
A synthetic peptide corresponding to a sequence at the C-terminus of human HNF1 beta (496-525aa AQQPFMAAVTQLQNSHMYAHKQEPPQYSHT), identical to the related mouse and rat sequences.A synthetic peptide corresponding to a sequence at the C-terminus of human HNF1 beta (496-525aa AQQPFMAAVTQLQNSHMYAHKQEPPQYSHT), identical to the related mouse and rat sequences.

Form: Lyophilized; Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Specificity:
No cross reactivity with other proteins.

Reactivity: Reacts with: human, rat

Applications: WB

Reconstitution:
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.
More Information
Is Featured? No
Write Your Own Review
You're reviewing:HNF1 beta polyclonal, anti-human, rat