HnRNP A1 Picoband polyclonal, anti-human, mouse, rat

HnRNP A1 Picoband polyclonal, anti-human, mouse, rat

€455.00
In stock
SKU
AC-ABO10189
Catalog Number: AC-ABO10189
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB, IHC-P
Datasheet
Request Information
Description: Rabbit IgG polyclonal antibody for Heterogeneous nuclear ribonucleoprotein A1(HNRNPA1) detection. Tested with WB, IHC-P in Human;Mouse;Rat.Protein Name: Heterogeneous nuclear ribonucleoprotein A1

Protein Function:
Involved in the packaging of pre-mRNA into hnRNP particles, transport of poly(A) mRNA from the nucleus to the cytoplasm and may modulate splice site selection. May play a role in HCV RNA replication. .

Other Names: Heterogeneous nuclear ribonucleoprotein A1, hnRNP A1, Helix-destabilizing protein, Single-strand RNA-binding protein, hnRNP core protein A1, Heterogeneous nuclear ribonucleoprotein A1, N-terminally processed, HNRNPA1, HNRPA1

Subcellular Localization: Nucleus. Cytoplasm. Localized in cytoplasmic mRNP granules containing untranslated mRNAs. Shuttles continuously between the nucleus and the cytoplasm along with mRNA. Component of ribonucleosomes. In the course of viral infection, colocalizes with HCV NS5B at speckles in the cytoplasm in a HCV-replication dependent manner.

Gene ID: 3178

Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human HnRNP A1 (8-42aa KEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTD), identical to the related mouse and rat sequences.

Calculated MW: 38747

Purification: Immunogen affinity purified.

Format: Lyophilized

Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
More Information
Is Featured? No
Write Your Own Review
You're reviewing:HnRNP A1 Picoband polyclonal, anti-human, mouse, rat