HnRNP H Picoband polyclonal, anti-human

HnRNP H Picoband polyclonal, anti-human

€455.00
In stock
SKU
AC-ABO10338
Catalog Number: AC-ABO10338
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB
Datasheet
Request Information
Description: Rabbit IgG polyclonal antibody for Heterogeneous nuclear ribonucleoprotein H (HNRNPH1) detection. Tested with WB in Human.Protein Name: Heterogeneous nuclear ribonucleoprotein H

Protein Function:
This protein is a component of the heterogeneous nuclear ribonucleoprotein (hnRNP) complexes which provide the substrate for the processing events that pre-mRNAs undergo before becoming functional, translatable mRNAs in the cytoplasm. Mediates pre-mRNA alternative splicing regulation. Inhibits, together with CUGBP1, insulin receptor (IR) pre-mRNA exon 11 inclusion in myoblast. Binds to the IR RNA. Binds poly(RG). .

Other Names: Heterogeneous nuclear ribonucleoprotein H, hnRNP H, Heterogeneous nuclear ribonucleoprotein H, N-terminally processed, HNRNPH1, HNRPH, HNRPH1

Subcellular Localization: Nucleus, nucleoplasm.

Tissue Specificity: Expressed ubiquitously.

Gene ID: 3187

Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human HnRNP H (23-52aa SADEVQRFFSDCKIQNGAQGIRFIYTREGR), identical to the related mouse and rat sequences.

Calculated MW: 49229

Purification: Immunogen affinity purified.

Format: Lyophilized

Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
More Information
Is Featured? No
Write Your Own Review
You're reviewing:HnRNP H Picoband polyclonal, anti-human