HOXA1 Picoband polyclonal, anti-human antibody

HOXA1 Picoband polyclonal, anti-human antibody

€270.00
In stock
SKU
AC-ABO13012
Catalog Number: AC-ABO13012
Size: 100 µg
Host: rabbit IgGWB
Datasheet

Request Information
Description: Rabbit IgG polyclonal antibody for E74 like factor 1 detection. Tested with WB in human, mouse, rat.

Background:
Transcription factor that activates the LYN and BLK promoters. Appears to be required for the T-cell-receptor-mediated trans activation of HIV-2 gene expression. Binds specifically to two purine-rich motifs in the HIV-2 enhancer.

Subcellular Localization: Nucleus.

Tissue Specificity: In fetal tissues, it is highly expressed in heart, lung liver and kidney, and weakly expressed in brain. In adult, it is highly expressed in pancreas, spleen, thymus and peripheral blood leukocytes, expressed at moderate levels in heart, placenta, lung, liver, skeletal muscle, kidney, prostate, ovary, small intestine and colon, and weakly expressed in brain and testis.

Immunogen: A synthetic peptide corresponding to a sequence of human E74 like factor 1 (QPTQSPYPTQLFRTVHVVQPVQAVPEGEAARTSTMQDE).

Format: Lyophilized

Contents: Each vial contains 4 mg Trehalose, 0.9 mg NaCl, 0.2mg Na2HPO4, 0.05 mg NaN3.

Storage: At -20˚C; for one year. After reconstitution, at 4˚C; for one month. It can also be aliquotted and stored frozen at -20˚C; for a longer time. Avoid repeated freezing and thawing.
More Information
Is Featured? No
Write Your Own Review
You're reviewing:HOXA1 Picoband polyclonal, anti-human antibody