HOXA5 Picoband polyclonal, anti-human, mouse, rat

HOXA5 Picoband polyclonal, anti-human, mouse, rat

€455.00
In stock
SKU
AC-ABO13023
Catalog Number: AC-ABO13023
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB
Datasheet
Request Information
Description: Rabbit IgG polyclonal antibody for HOXA5 detection. Tested with WB in Human;Mouse;Rat.

Protein Function:
Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis. Also binds to its own promoter. Binds specifically to the motif 5'-CYYNATTA[TG]Y-3'.

Other Names: Homeobox protein Hox-A5, Homeobox protein Hox-1C, HOXA5, HOX1C

Subcellular Localization: Nucleus.

Gene ID: 3202

Immunogen: A synthetic peptide corresponding to a sequence of human HOXA5 (AQPQIYPWMRKLHISHDNIGGPEGKRARTAYTRYQTLELEK).

Calculated MW: 29345

Format: Lyophilized

Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Contents: Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Storage: At -20˚C; for one year. After reconstitution, at 4˚C; for one month. It can also be aliquotted and stored frozen at -20˚C; for a longer time. Avoid repeated freezing and thawing.
More Information
Is Featured? No
Write Your Own Review
You're reviewing:HOXA5 Picoband polyclonal, anti-human, mouse, rat