HSD11B2 polyclonal, anti-human, mouse, rat

HSD11B2 polyclonal, anti-human, mouse, rat

€455.00
In stock
SKU
AC-ABO12771
Catalog Number: AC-ABO12771
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB, IHC-P
Datasheet
Request Information
Description: Rabbit IgG polyclonal antibody for Corticosteroid 11-beta-dehydrogenase isozyme 2(HSD11B2) detection. Tested with WB, IHC-P in Human;Mouse;Rat.Protein Name: Corticosteroid 11-beta-dehydrogenase isozyme 2

Protein Function:
Catalyzes the conversion of cortisol to the inactive metabolite cortisone. Modulates intracellular glucocorticoid levels, thus protecting the nonselective mineralocorticoid receptor from occupation by glucocorticoids.

Other Names: Corticosteroid 11-beta-dehydrogenase isozyme 2, 1.1.1.-, 11-beta-hydroxysteroid dehydrogenase type 2, 11-DH2, 11-beta-HSD2, 11-beta-hydroxysteroid dehydrogenase type II, 11-HSD type II, 11-beta-HSD type II, NAD-dependent 11-beta-hydroxysteroid dehydrogenase, 11-beta-HSD, Short chain dehydrogenase/reductase family 9C member 3, HSD11B2, HSD11K {ECO:0000303|PubMed:8530071}, SDR9C3

Subcellular Localization: Microsome . Endoplasmic reticulum .

Tissue Specificity: Expressed in kidney, pancreas, prostate, ovary, small intestine and colon. At midgestation, expressed at high levels in placenta and in fetal kidney and, at much lower levels, in fetal lung and testis (PubMed:8530071). .

Gene ID: 3291

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human HSD11B2 (277-309aa EKRKQLLLANLPQELLQAYGKDYIEHLHGQFLH), different from the related mouse sequence by five amino acids, and from the related rat sequence by three amino acids.

Calculated MW: 44127

Purification: Immunogen affinity purified.

Format: Lyophilized

Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
More Information
Is Featured? No
Write Your Own Review
You're reviewing:HSD11B2 polyclonal, anti-human, mouse, rat