HSD11B2 polyclonal, anti-human, mouse, rat

HSD11B2 polyclonal, anti-human, mouse, rat

€354.00
In stock
SKU
ARP-10-R1094
Catalog Number: 10-R1094
Isotype: rabbit polyclonal IgG

Information
Questions? Contact us!


Quantity: 100 µg

Background:
Corticosteroid 11-β-dehydrogenase isozyme 2, also known as 11-β-hydroxysteroid dehydrogenase 2, is an enzyme that in humans is encoded by the HSD11B2 gene. There are at least two isozymes of the corticosteroid 11-beta-dehydrogenase, a microsomal enzyme complex responsible for the interconversion of cortisol and cortisone. The type I isozyme has both 11-beta-dehydrogenase (cortisol to cortisone) and 11-oxoreductase (cortisone to cortisol) activities. The type II isozyme, encoded by this gene, has only 11-beta-dehydrogenase activity. In aldosterone-selective epithelial tissues such as the kidney, the type II isozyme catalyzes the glucocorticoid cortisol to the inactive metabolite cortisone, thus preventing illicit activation of the mineralocorticoid receptor. In tissues that do not express the mineralocorticoid receptor, such as the placenta and testis, it protects cells from the growth-inhibiting and/or pro-apoptotic effects of cortisol, particularly during embryonic development. Mutations in this gene cause the syndrome of apparent mineralocorticoid excess and hypertension.

Description:
Rabbit IgG polyclonal antibody for Corticosteroid 11-beta-dehydrogenase isozyme 2 (HSD11B2) detection. Tested with WB, IHC-P in Human, Mouse, Rat.

Synonyms:
11 beta HSD2 antibody, 11 beta hydroxysteroid dehydrogenase type 2 antibody, 11 DH2 antibody, 11-beta-HSD2 antibody, 11-beta-hydroxysteroid dehydrogenase type 2 antibody, 11-DH2 antibody, AME antibody, AME1 antibody, Corticosteroid 11 beta dehydrogenase isozyme 2 antibody, Corticosteroid 11-beta-dehydrogenase isozyme 2 antibody, DHI2_HUMAN antibody, HSD11B2 antibody, HSD11K antibody, HSD2 antibody, Hydroxysteroid 11 beta dehydrogenase 2 antibody, Hydroxysteroid 11 beta dehydrogenase isoenzyme 2 antibody, NAD dependent 11 beta hydroxysteroid dehydrogenase antibody, NAD-dependent 11-beta-hydroxysteroid dehydrogenase antibody, SDR9C3 antibody, Short chain dehydrogenase/reductase family 9C, member 3 antibody

Isotype: Rabbit polyclonal IgG

Immunogen:
A synthetic peptide corresponding to a sequence at the C-terminus of human HSD11B2 (277-309aa EKRKQLLLANLPQELLQAYGKDYIEHLHGQFLH), different from the related mouse sequence by five amino acids, and from the related rat sequence by three amino acids.

Form: Lyophilized; Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Specificity:
No cross reactivity with other proteins.

Reactivity: Reacts with: human, mouse, rat

Applications: WB, IHC-P

Reconstitution:
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.
More Information
Is Featured? No
Write Your Own Review
You're reviewing:HSD11B2 polyclonal, anti-human, mouse, rat