Hsp70 Picoband polyclonal, anti-human, mouse, rat

Hsp70 Picoband polyclonal, anti-human, mouse, rat

€455.00
In stock
SKU
AC-ABO12324
Catalog Number: AC-ABO12324
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB, IHC-P
Datasheet
Request Information
Description: Rabbit IgG polyclonal antibody for Heat shock 70 kDa protein 1A/1B(HSPA1A/HSPA1B) detection. Tested with WB, IHC-P in Human;Mouse;Rat.Protein Name: Heat shock 70 kDa protein 1A/1B

Protein Function:
In cooperation with other chaperones, Hsp70s stabilize preexistent proteins against aggregation and mediate the folding of newly translated polypeptides in the cytosol as well as within organelles. These chaperones participate in all these processes through their ability to recognize nonnative conformations of other proteins. They bind extended peptide segments with a net hydrophobic character exposed by polypeptides during translation and membrane translocation, or following stress-induced damage. In case of rotavirus A infection, serves as a post-attachment receptor for the virus to facilitate entry into the cell. Essential for STUB1-mediated ubiquitination and degradation of FOXP3 in regulatory T-cells (Treg) during inflammation (PubMed:23973223). .

Other Names: Heat shock 70 kDa protein 1A {ECO:0000312|HGNC:HGNC:5232}, Heat shock 70 kDa protein 1, HSP70-1, HSP70.1, HSPA1A, HSPA1, HSX70

Subcellular Localization: Cytoplasm . Localized in cytoplasmic mRNP granules containing untranslated mRNAs.

Gene ID: 3303;3304

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Hsp70 (559-596aa KGKISEADKKKVLDKCQEVISWLDANTLAEKDEFEHKR), different from the related mouse sequence by five amino acids, and from the related rat sequence by three amino acids.

Calculated MW: 70052

Purification: Immunogen affinity purified.

Format: Lyophilized

Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
More Information
Is Featured? No
Write Your Own Review
You're reviewing:Hsp70 Picoband polyclonal, anti-human, mouse, rat