Hsp70 polyclonal, anti-human, mouse, rat

Hsp70 polyclonal, anti-human, mouse, rat

€384.00
In stock
SKU
ARP-10-P9638
Catalog Number: 10-P9638
Isotype: rabbit polyclonal IgG

Information
Questions? Contact us!


Quantity: 100 µg

Background:
HSPA1 (heat shock 70kDa protein 1A) also known as HSP70-1, HSPA1A, HSP70-1A, HSP72 or HSP70I, is a protein that in humans is encoded by the HSPA1A gene. This intronless gene encodes a 70kDa heat shock protein which is a member of the heat shock protein 70 family. The HSPA1A gene encodes a predicted 641-amino acid protein. The HSPA1 gene is mapped on 6p21.33. Shimizu et al. (1999) found that peripheral blood mononuclear cells of 18 major depression patients expressed a short HSPA1A transcript that utilized exon 1 rather than exon 2, which is found in the more common HSPA1A transcript. No protein was associated with expression of this short HSPA1A mRNA, possibly due to lack of a TATA box or loss of internal ribosome binding sites. Treatment with BGP-15, a pharmacologic inducer of Hsp72 that can protect against obesity-induced insulin resistance, improved muscular architecture, strength, and contractile function in severely affected diaphragm muscles in mdx dystrophic mice.

Description:
Rabbit IgG polyclonal antibody for Heat shock 70 kDa protein 1A/1B (HSPA1A) detection. Tested with WB, IHC-P in Human, Mouse, Rat.

Synonyms:
DAQB 147D11.1 001 antibody, FLJ54303 antibody, FLJ54370 antibody, FLJ54392 antibody, FLJ54408 antibody, FLJ75127 antibody, Heat shock 70 kDa protein 1 antibody, Heat shock 70 kDa protein 1/2 antibody, Heat shock 70 kDa protein 1A/1B antibody, heat shock 70kDa protein 1A antibody, Heat shock 70kDa protein 1B antibody, Heat shock induced protein antibody, heat shock protein 70 antibody, HSP70 1 antibody, HSP70 2 antibody, HSP70-1/HSP70-2 antibody, HSP70-1A antibody, HSP70.1 antibody, HSP70.1/HSP70.2 antibody, HSP70I antibody, HSP71_HUMAN antibody, HSP72 antibody, HSPA1 antibody, HSPA1A antibody, HSPA1B antibody, XXbac BCX40G17.3 001 antibody.

Isotype: Rabbit polyclonal IgG

Immunogen:
A synthetic peptide corresponding to a sequence at the C-terminus of human Hsp70 (559-596aa KGKISEADKKKVLDKCQEVISWLDANTLAEKDEFEHKR), different from the related mouse sequence by five amino acids, and from the related rat sequence by three amino acids.

Form: Lyophilized; Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Specificity:
No cross reactivity with other proteins.

Reactivity: Reacts with: human, mouse, rat

Applications: WB, IHC-P

Reconstitution:
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.
More Information
Is Featured? No
Write Your Own Review
You're reviewing:Hsp70 polyclonal, anti-human, mouse, rat