Hsp90 alpha polyclonal, anti-human, mouse, rat
€384.00
In stock
SKU
ARP-10-P9635
Quantity: 100 µg
Background:
Heat shock protein HSP 90-alpha is a protein that in humans is encoded by the HSP90AA1 gene. The gene, HSP90AA1, encodes the human stress-inducible 90-kDa heat shock protein alpha (Hsp90A). Complemented by the constitutively expressed paralog Hsp90B which shares over 85% amino acid sequence identity, Hsp90A expression is initiated when a cell experiences proteotoxic stress. Once expressed Hsp90A dimers operate as molecular chaperones that bind and fold other proteins into their functional 3-dimensional structures. This molecular chaperoning ability of Hsp90A is driven by a cycle of structural rearrangements fueled by ATP hydrolysis. Current research on Hsp90A focuses in its role as a drug target due to its interaction with a large number of tumor promoting proteins and its role in cellular stress adaptation.
Description:
Rabbit IgG polyclonal antibody for Heat shock protein HSP 90-alpha (HSP90AA1) detection. Tested with WB, IHC-P in Human, Mouse, Rat.
Synonyms:
EL52 antibody, epididymis luminal secretory protein 52 antibody, Heat shock 86 kDa antibody, heat shock 90kD protein 1, alpha antibody, Heat shock 90kD protein 1, alpha like 4 antibody, heat shock 90kD protein, alpha-like 4 antibody, Heat shock 90kDa protein 1 alpha antibody, Heat shock protein 90kDa alpha (cytosolic) class A member 1 antibody, heat shock protein 90kDa alpha (cytosolic), class A member 2 antibody, Heat shock protein HSP 90-alpha antibody, HS90A_HUMAN antibody, HSP 86 antibody, HSP 86 antibody, HSP86 antibody, Hsp89 antibody, HSP89A antibody, Hsp90 antibody, HSP90A antibody, HSP90AA1 antibody, HSP90ALPHA antibody, HSP90N antibody, HSPC1 antibody, HSPCA antibody, HSPCAL1 antibody, HSPCAL3 antibody, HSPCAL4 antibody, HSPN antibody, LAP 2 antibody, LAP2 antibody, lipopolysaccharide-associated protein 2 antibody, LPS-associated protein 2 antibody, Renal carcinoma antigen NY REN 38 antibody, Renal carcinoma antigen NY-REN-38 antibody
Isotype: Rabbit polyclonal IgG
Immunogen:
A synthetic peptide corresponding to a sequence at the C-terminus of human Hsp90 alpha (454-488aa QNRKKLSELLRYYTSASGDEMVSLKDYCTRMKEN Q), identical to the related mouse and rat sequences.
Form: Lyophilized; Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Specificity:
No cross reactivity with other proteins.
Reactivity: Reacts with: human, mouse, rat
Applications: WB, IHC-P
Reconstitution:
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.
| Is Featured? | No |
|---|
Write Your Own Review