Hsp90 Beta Picoband polyclonal, anti-human, mouse, rat

Hsp90 Beta Picoband polyclonal, anti-human, mouse, rat

€455.00
In stock
SKU
AC-ABO12322
Catalog Number: AC-ABO12322
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB, IHC, IHC-P, ICC
Datasheet
Request Information
Description: Rabbit IgG polyclonal antibody for Heat shock protein HSP 90-beta(HSP90AB1) detection. Tested with WB, IHC-P in Human;Mouse;Rat.Protein Name: Heat shock protein HSP 90-beta

Protein Function:
Molecular chaperone that promotes the maturation, structural maintenance and proper regulation of specific target proteins involved for instance in cell cycle control and signal transduction. Undergoes a functional cycle that is linked to its ATPase activity. This cycle probably induces conformational changes in the client proteins, thereby causing their activation. Interacts dynamically with various co-chaperones that modulate its substrate recognition, ATPase cycle and chaperone function. .

Other Names: Heat shock protein HSP 90-beta, HSP 90, Heat shock 84 kDa, HSP 84, HSP84, HSP90AB1, HSP90B, HSPC2, HSPCB

Subcellular Localization: Cytoplasm. Melanosome. Identified by mass spectrometry in melanosome fractions from stage I to stage IV.

Gene ID: 3326

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Hsp90 beta (449-481aa RRLSELLRYHTSQSGDEMTSLSEYVSRMKETQK), identical to the related mouse and rat sequences.

Calculated MW: 83264

Purification: Immunogen affinity purified.

Format: Lyophilized

Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
More Information
Is Featured? No
Write Your Own Review
You're reviewing:Hsp90 Beta Picoband polyclonal, anti-human, mouse, rat