Hsp90 beta polyclonal, anti-human, mouse, rat

Hsp90 beta polyclonal, anti-human, mouse, rat

€384.00
In stock
SKU
ARP-10-P9636
Catalog Number: 10-P9636
Isotype: rabbit polyclonal IgG

Information
Questions? Contact us!


Quantity: 100 µg

Background:
Heat shock protein HSP 90-beta, also called HSP90beta, is a protein that in humans is encoded by the HSP90AB1 gene. It is mapped to chromosome 6p21.1. This gene encodes a member of the heat shock protein 90 family; these proteins are involved in signal transduction, protein folding and degradation and morphological evolution. And this gene is thought to play a role in gastric apoptosis and inflammation. Alternative splicing results in multiple transcript variants. Pseudogenes have been identified on multiple chromosomes.

Description:
Rabbit IgG polyclonal antibody for Heat shock protein HSP 90-beta (HSP90AB1) detection. Tested with WB, IHC-P in Human, Mouse, Rat.

Synonyms:
90 kda heat shock protein beta HSP90 beta antibody, D6S182 antibody, FLJ26984 antibody, Heat shock 84 kDa antibody, Heat shock 90kD protein 1, beta antibody, Heat shock 90kDa protein 1 beta antibody, Heat shock protein 90kDa alpha (cytosolic) class B member 1 antibody, Heat shock protein beta antibody, Heat shock protein HSP 90 beta antibody, Heat shock protein HSP 90-beta antibody, HS90B_HUMAN antibody, HSP 84 antibody, HSP 90 antibody, HSP 90 b antibody, HSP 90b antibody, HSP84 antibody, HSP90 BETA antibody, hsp90ab1 antibody, HSP90B antibody, HSPC2 antibody, HSPCB antibody

Isotype: Rabbit polyclonal IgG

Immunogen:
A synthetic peptide corresponding to a sequence at the C-terminus of human Hsp90 beta (449-481aa RRLSELLRYHTSQSGDEMTSLSEYVSRMKETQK), identical to the related mouse and rat sequences.

Form: Lyophilized; Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Specificity:
No cross reactivity with other proteins.

Reactivity: Reacts with: human, mouse, rat

Applications: WB, IHC-P

Reconstitution:
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.
More Information
Is Featured? No
Write Your Own Review
You're reviewing:Hsp90 beta polyclonal, anti-human, mouse, rat