HSPA2 Picoband polyclonal, anti-human, mouse, rat

HSPA2 Picoband polyclonal, anti-human, mouse, rat

€455.00
In stock
SKU
AC-ABO12325
Catalog Number: AC-ABO12325
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB, IHC-P
Datasheet
Request Information
Description: Rabbit IgG polyclonal antibody for Heat shock-related 70 kDa protein 2(HSPA2) detection. Tested with WB, IHC-P in Human;Mouse;Rat.Protein Name: Heat shock-related 70 kDa protein 2

Protein Function:
In cooperation with other chaperones, Hsp70s stabilize preexistent proteins against aggregation and mediate the folding of newly translated polypeptides in the cytosol as well as within organelles. These chaperones participate in all these processes through their ability to recognize nonnative conformations of other proteins. They bind extended peptide segments with a net hydrophobic character exposed by polypeptides during translation and membrane translocation, or following stress-induced damage.

Other Names: Heat shock-related 70 kDa protein 2, Heat shock 70 kDa protein 2, HSPA2

Gene ID: 3306

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human HSPA2 (564-598aa KISEQDKNKILDKCQEVINWLDRNQMAEKDEYEHK), identical to the related mouse and rat sequences.

Calculated MW: 70021

Purification: Immunogen affinity purified.

Format: Lyophilized

Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
More Information
Is Featured? No
Write Your Own Review
You're reviewing:HSPA2 Picoband polyclonal, anti-human, mouse, rat