HSPA2 polyclonal, anti-human, mouse, rat
€384.00
In stock
SKU
ARP-10-P9639
Quantity: 100 µg
Background:
HSPA2 (heat shock 70kDa protein 2) is also known as HEAT-SHOCK PROTEIN, 70-KD, 2, HSP70-2, HEAT-SHOCK PROTEIN, 70-KD, 3 or HSP70-3. Analysis of the sequence indicated that HSPA2 is the human homolog of the murine Hsp70-2 gene, with 91.7% identity in the nucleotide coding sequence and 98.2% in the corresponding amino acid sequence. HSPA2 has less amino acid homology to the other members of the human HSP70 gene family. HSPA2 is constitutively expressed in most tissues, with very high levels in testis and skeletal muscle. The HSPA2 gene is located on chromosome 14q22-q24. Immunohistochemical analysis detected weak expression of HSPA2 in spermatocytes and stronger expression in spermatids and in the tail of mature sperm. HSPA2 may be critical to sperm maturation through its role as a protein chaperone.
Description:
Rabbit IgG polyclonal antibody for Heat shock-related 70 kDa protein 2 (HSPA2) detection. Tested with WB, IHC-P in Human, Mouse, Rat.
Synonyms:
70kDa antibody, DAQB 147D11.1 001 antibody, Hcp70.2 antibody, Heat shock 70 kDa protein 2 antibody, heat shock 70kDa protein 1A antibody, Heat shock protein 2 antibody, heat shock protein 70 antibody, Heat shock protein 70.2 antibody, Heat shock related 70 kDa protein 2 antibody, Heat shock-related 70 kDa protein 2 antibody, Heat-shock protein, 70-KD, 2 antibody, Heat-shock protein, 70-KD, 3 antibody, HSP70 2 antibody, HSP70 3 antibody, Hsp70-2 antibody, HSP70-3 antibody, HSP70.2 antibody, HSP70A2 antibody, HSP72 antibody, HSP72_HUMAN antibody, HSPA2 antibody, Hspt70 antibody, Hst70 antibody, MGC58299 antibody, MGC7795 antibody, MGC93458 antibody, OTTHUMP00000180664 antibody, Testis-specific heat shock protein-related antibody, XXbac BCX40G17.3 001 antibody.
Isotype: Rabbit polyclonal IgG
Immunogen:
A synthetic peptide corresponding to a sequence at the C-terminus of human HSPA2 (564-598aa KISEQDKNKILDKCQEVINWLDRNQMAEKDEYEHK), identical to the related mouse and rat sequences.
Form: Lyophilized; Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Specificity:
No cross reactivity with other proteins.
Reactivity: Reacts with: human, mouse, rat
Applications: WB, IHC-P
Reconstitution:
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.
| Is Featured? | No |
|---|
Write Your Own Review