Iba1 Picoband polyclonal, anti-human
€455.00
In stock
SKU
AC-ABO10182
Catalog Number: AC-ABO10182
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB, IHC-P
Datasheet
Request Information
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB, IHC-P
Datasheet
Request Information
Description: Rabbit IgG polyclonal antibody for Allograft inflammatory factor 1(AIF1) detection. Tested with WB, IHC-P in Human.Protein Name: Allograft inflammatory factor 1
Protein Function:
Actin-binding protein that enhances membrane ruffling and RAC activation. Enhances the actin-bundling activity of LCP1. Binds calcium. Plays a role in RAC signaling and in phagocytosis. May play a role in macrophage activation and function. Promotes the proliferation of vascular smooth muscle cells and of T- lymphocytes. Enhances lymphocyte migration. Plays a role in vascular inflammation. .
Other Names: Allograft inflammatory factor 1, AIF-1, Ionized calcium-binding adapter molecule 1, Protein G1, AIF1, G1, IBA1
Subcellular Localization: Cytoplasm, cytoskeleton. Cell projection, ruffle membrane; Peripheral membrane protein; Cytoplasmic side. Associated with the actin cytoskeleton at membrane ruffles and at sites of phagocytosis.
Tissue Specificity: Detected in T-lymphocytes and peripheral blood mononuclear cells. .
Gene ID: 199
Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Iba1 (99-133aa ETFSYPDFLRMMLGKRSAILKMILMYEEKAREKEK), different from the related mouse sequence by seven amino acids, and from the related rat sequence by six amino acids.
Calculated MW: 16703
Purification: Immunogen affinity purified.
Format: Lyophilized
Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
Protein Function:
Actin-binding protein that enhances membrane ruffling and RAC activation. Enhances the actin-bundling activity of LCP1. Binds calcium. Plays a role in RAC signaling and in phagocytosis. May play a role in macrophage activation and function. Promotes the proliferation of vascular smooth muscle cells and of T- lymphocytes. Enhances lymphocyte migration. Plays a role in vascular inflammation. .
Other Names: Allograft inflammatory factor 1, AIF-1, Ionized calcium-binding adapter molecule 1, Protein G1, AIF1, G1, IBA1
Subcellular Localization: Cytoplasm, cytoskeleton. Cell projection, ruffle membrane; Peripheral membrane protein; Cytoplasmic side. Associated with the actin cytoskeleton at membrane ruffles and at sites of phagocytosis.
Tissue Specificity: Detected in T-lymphocytes and peripheral blood mononuclear cells. .
Gene ID: 199
Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Iba1 (99-133aa ETFSYPDFLRMMLGKRSAILKMILMYEEKAREKEK), different from the related mouse sequence by seven amino acids, and from the related rat sequence by six amino acids.
Calculated MW: 16703
Purification: Immunogen affinity purified.
Format: Lyophilized
Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
| Is Featured? | No |
|---|
Write Your Own Review