IBSP Picoband polyclonal, anti-human, mouse, rat

IBSP Picoband polyclonal, anti-human, mouse, rat

€455.00
In stock
SKU
AC-ABO13006
Catalog Number: AC-ABO13006
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB
Datasheet
Request Information
Description: Rabbit IgG polyclonal antibody for IBSP detection. Tested with WB in Human;Mouse;Rat.

Protein Function:
Binds tightly to hydroxyapatite. Appears to form an integral part of the mineralized matrix. Probably important to cell-matrix interaction. Promotes Arg-Gly-Asp-dependent cell attachment.

Subcellular Localization: Secreted.

Immunogen: A synthetic peptide corresponding to a sequence of human IBSP (FSMKNLHRRVKIEDSEENGVFKYRPRYYLYKHAYFYPHLKRFPVQ).

Purification: Immunogen affinity purified.

Format: Lyophilized

Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.
More Information
Is Featured? No
Write Your Own Review
You're reviewing:IBSP Picoband polyclonal, anti-human, mouse, rat