ICA1 Picoband polyclonal, anti-human, mouse, rat

ICA1 Picoband polyclonal, anti-human, mouse, rat

€455.00
In stock
SKU
AC-ABO12183
Catalog Number: AC-ABO12183
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB
Datasheet
Request Information
Description: Rabbit IgG polyclonal antibody for Islet cell autoantigen 1(ICA1) detection. Tested with WB in Human;Mouse;Rat.Protein Name: Islet cell autoantigen 1

Protein Function:
May play a role in neurotransmitter secretion. .

Other Names: Islet cell autoantigen 1, 69 kDa islet cell autoantigen, ICA69, Islet cell autoantigen p69, ICAp69, p69, ICA1

Subcellular Localization: Cytoplasm, cytosol . Golgi apparatus membrane ; Peripheral membrane protein . Cytoplasmic vesicle, secretory vesicle membrane ; Peripheral membrane protein . Cytoplasmic vesicle, secretory vesicle, synaptic vesicle membrane ; Peripheral membrane protein . Predominantly cytosolic. Also exists as a membrane-bound form which has been found associated with synaptic vesicles and also with the Golgi complex and immature secretory granules.

Tissue Specificity: Expressed abundantly in pancreas, heart and brain with low levels of expression in lung, kidney, liver and thyroid.

Gene ID: 3382

Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human ICA1 (243-276aa EKTSHTMAAIHESFKGYQPYEFTTLKSLQDPMKK), identical to the related mouse and rat sequences.

Calculated MW: 54645

Purification: Immunogen affinity purified.

Format: Lyophilized

Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
More Information
Is Featured? No
Write Your Own Review
You're reviewing:ICA1 Picoband polyclonal, anti-human, mouse, rat