IDH1 Picoband polyclonal, anti-human, mouse, rat

IDH1 Picoband polyclonal, anti-human, mouse, rat

€455.00
In stock
SKU
AC-ABO12287
Catalog Number: AC-ABO12287
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB, IHC, IHC-P, IHC-F, ICC
Datasheet
Request Information
Description: Rabbit IgG polyclonal antibody for Isocitrate dehydrogenase [NADP] cytoplasmic(IDH1) detection. Tested with WB, IHC-P, IHC-F in Human;Mouse;Rat. Protein Name: Isocitrate dehydrogenase [NADP] cytoplasmic

Other Names: Isocitrate dehydrogenase [NADP] cytoplasmic, IDH, 1.1.1.42, Cytosolic NADP-isocitrate dehydrogenase, IDP, NADP(+)-specific ICDH, Oxalosuccinate decarboxylase, IDH1, PICD

Subcellular Localization: Cytoplasm . Peroxisome .

Gene ID: 3417

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human IDH1 (381-413aa KGLPNVQRSDYLNTFEFMDKLGENLKIKLAQAK), different from the related mouse and rat sequences by one amino acid.

Calculated MW: 46659

Purification: Immunogen affinity purified.

Format: Lyophilized

Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
More Information
Is Featured? No
Write Your Own Review
You're reviewing:IDH1 Picoband polyclonal, anti-human, mouse, rat