IDH1 polyclonal, anti-human, mouse, rat

Quantity: 100 µg

Background:
Isocitrate dehydrogenase 1 (NADP+), soluble is an enzyme that in humans is encoded by the IDH1 gene. Isocitrate dehydrogenases catalyze the oxidative decarboxylation of isocitrate to 2-oxoglutarate. These enzymes belong to two distinct subclasses, one of which utilizes NAD(+) as the electron acceptor and the other NADP(+). Five isocitrate dehydrogenases have been reported: three NAD(+)-dependent isocitrate dehydrogenases, which localize to the mitochondrial matrix, and two NADP(+)-dependent isocitrate dehydrogenases, one of which is mitochondrial and the other predominantly cytosolic. Each NADP(+)-dependent isozyme is a homodimer. The protein encoded by this gene is the NADP(+)-dependent isocitrate dehydrogenase found in the cytoplasm and peroxisomes. It contains the PTS-1 peroxisomal targeting signal sequence. The presence of this enzyme in peroxisomes suggests roles in the regeneration of NADPH for intraperoxisomal reductions, such as the conversion of 2, 4-dienoyl-CoAs to 3-enoyl-CoAs, as well as in peroxisomal reactions that consume 2-oxoglutarate, namely the alpha-hydroxylation of phytanic acid. The cytoplasmic enzyme serves a significant role in cytoplasmic NADPH production. Alternatively spliced transcript variants encoding the same protein have been found for this gene.

Description:
Rabbit IgG polyclonal antibody for Isocitrate dehydrogenase [NADP] cytoplasmic (IDH1) detection. Tested with WB, IHC-P in Human, Mouse, Rat.

Synonyms:
Cytosolic NADP isocitrate dehydrogenase antibody, Cytosolic NADP-isocitrate dehydrogenase antibody, Epididymis luminal protein 216 antibody, Epididymis secretory protein Li 26 antibody, HEL-216 antibody, HEL-S-26 antibody, ICDH antibody, IDCD antibody, IDH antibody, IDH1 antibody, IDHC_HUMAN antibody, IDP antibody, IDPC antibody, Isocitrate dehydrogenase [NADP] cytoplasmic antibody, Isocitrate dehydrogenase 1 (NADP+) soluble antibody, NADP dependent isocitrate dehydrogenase cytosolic antibody, NADP dependent isocitrate dehydrogenase peroxisomal antibody, NADP(+)-specific ICDH antibody, Oxalosuccinate decarboxylase antibody, PICD antibody

Isotype: Rabbit polyclonal IgG

Immunogen:
A synthetic peptide corresponding to a sequence at the C-terminus of human IDH1 (381-413aa KGLPNVQRSDYLNTFEFMDKLGENLKIKLAQAK), different from the related mouse and rat sequences by one amino acid.

Form: Lyophilized; Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Specificity:
No cross reactivity with other proteins.

Reactivity: Reacts with: human, mouse, rat

Applications: WB, IHC-P

Reconstitution:
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.