IDO1 polyclonal, anti-human, mouse, rat
€384.00
In stock
SKU
ARP-10-P9603
Quantity: 100 µg
Background:
IDO1 (INDOLEAMINE 2,3-DIOXYGENASE), INDO or IDO, is an immunomodulatory enzyme produced by some alternatively activated macrophages and other immunoregulatory cells. This enzyme catalyzes the degradation of the essential amino acid L-tryptophan to N-formyl-kynurenine. By fluorescence in situ hybridization, the assignment is narrowed to chromosome 8p12-p11. INDO Interferon-gamma has an antiproliferative effect on many tumor cells and inhibits intracellular pathogens such as Toxoplasma and chlamydia, at least partly because of the induction of indoleamine 2,3-dioxygenase. During inflammation, IDO is upregulated in dendritic cells and phagocytes by proinflammatory stimuli, most notably IFNG, and the enzyme then uses superoxide as a 'cofactor' for oxidative cleavage of the indole ring of tryptophan, yielding an intermediate that deformylates to L-kynurenine.
Description:
Rabbit IgG polyclonal antibody for Indoleamine 2,3-dioxygenase 1 (IDO1) detection. Tested with WB, IHC-P in Human, Mouse, Rat.
Synonyms:
3-dioxygenase antibody, I23O1_HUMAN antibody, IDO 1 antibody, IDO antibody, IDO-1 antibody, IDO1 antibody, INDO antibody, indolamine 2,3 dioxygenase antibody, Indole 2 3 dioxygenase antibody, indoleamine 2 3 dioxygenase 1 antibody, indoleamine 2 3 dioxygenase antibody, Indoleamine 2,3-dioxygenase 1 antibody, Indoleamine pyrrole 2 3 dioxygenase antibody, Indoleamine-pyrrole 2 antibody.
Isotype: Rabbit polyclonal IgG
Immunogen:
A synthetic peptide corresponding to a sequence at the N-terminus of human IDO1 (37-69aa NDWMFIAKHLPDLIESGQLRERVEKLNMLSIDH), different from the related mouse sequence by fourteen amino acids, and from the related rat sequence by seventeen amino acids.
Form: Lyophilized; Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Specificity:
No cross reactivity with other proteins.
Reactivity: Reacts with: human, mouse, rat
Applications: WB, IHC-P
Reconstitution:
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.
| Is Featured? | No |
|---|
Write Your Own Review