IFNGR1 Picoband polyclonal, anti-human

IFNGR1 Picoband polyclonal, anti-human

€455.00
In stock
SKU
AC-ABO10208
Catalog Number: AC-ABO10208
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB
Datasheet
Request Information
Description: Rabbit IgG polyclonal antibody for Interferon gamma receptor 1(IFNGR1) detection. Tested with WB in Human.Protein Name: Interferon gamma receptor 1

Protein Function:
Associates with IFNGR2 to form a receptor for the cytokine interferon gamma (IFNG) (PubMed:7615558, PubMed:2971451, PubMed:7617032, PubMed:10986460). Ligand binding stimulates activation of the JAK/STAT signaling pathway (PubMed:7673114). .

Other Names: Interferon gamma receptor 1 {ECO:0000312|HGNC:HGNC:5439}, IFN-gamma receptor 1, IFN-gamma-R1, CDw119, Interferon gamma receptor alpha-chain, IFN-gamma-R-alpha, CD119, IFNGR1 (HGNC:5439)

Subcellular Localization: Cell membrane ; Single-pass type I membrane protein .

Gene ID: 3459

Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human IFNGR1 (108-147aa QKESAYAKSEEFAVCRDGKIGPPKLDIRKEEKQIMIDIFH), different from the related mouse sequence by eighteen amino acids.

Calculated MW: 54405

Purification: Immunogen affinity purified.

Format: Lyophilized

Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
More Information
Is Featured? No
Write Your Own Review
You're reviewing:IFNGR1 Picoband polyclonal, anti-human