IGFBP-1 polyclonal, anti-mouse, rat
€455.00
In stock
SKU
AC-ABO12290
Catalog Number: AC-ABO12290
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB, E
Datasheet
Request Information
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB, E
Datasheet
Request Information
Description: Rabbit IgG polyclonal antibody for Insulin-like growth factor-binding protein 1(IGFBP1) detection. Tested with WB, ELISA in Mouse;Rat.
Protein Name: Insulin-like growth factor-binding protein 1
Protein Function:
IGF-binding proteins prolong the half-life of the IGFs and have been shown to either inhibit or stimulate the growth promoting effects of the IGFs on cell culture. They alter the interaction of IGFs with their cell surface receptors. Promotes cell migration (By similarity). .
Other Names: Insulin-like growth factor-binding protein 1, IBP-1, IGF-binding protein 1, IGFBP-1, Igfbp1, Igfbp-1
Subcellular Localization: Secreted.
Gene ID: 16006
Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of mouse IGFBP-1 (177-207aa REIADLKKWKEPCQRELYKVLERLAAAQQKA), different from the related human sequence by eleven amino acids, and from the related rat sequence by one amino acid.
Calculated MW: 29570
Purification: Immunogen affinity purified.
Format: Lyophilized
Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
Protein Name: Insulin-like growth factor-binding protein 1
Protein Function:
IGF-binding proteins prolong the half-life of the IGFs and have been shown to either inhibit or stimulate the growth promoting effects of the IGFs on cell culture. They alter the interaction of IGFs with their cell surface receptors. Promotes cell migration (By similarity). .
Other Names: Insulin-like growth factor-binding protein 1, IBP-1, IGF-binding protein 1, IGFBP-1, Igfbp1, Igfbp-1
Subcellular Localization: Secreted.
Gene ID: 16006
Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of mouse IGFBP-1 (177-207aa REIADLKKWKEPCQRELYKVLERLAAAQQKA), different from the related human sequence by eleven amino acids, and from the related rat sequence by one amino acid.
Calculated MW: 29570
Purification: Immunogen affinity purified.
Format: Lyophilized
Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
| Is Featured? | No |
|---|
Write Your Own Review