IGFBP-3 polyclonal, anti-human, rat

IGFBP-3 polyclonal, anti-human, rat

€455.00
In stock
SKU
AC-ABO12396
Catalog Number: AC-ABO12396
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB, IHC-P, E
Datasheet
Request Information
Description: Rabbit IgG polyclonal antibody for Insulin-like growth factor-binding protein 3(IGFBP3) detection. Tested with WB, IHC-P, ELISA in Human;Rat.Protein Name: Insulin-like growth factor-binding protein 3

Protein Function:
IGF-binding proteins prolong the half-life of the IGFs and have been shown to either inhibit or stimulate the growth promoting effects of the IGFs on cell culture. They alter the interaction of IGFs with their cell surface receptors. Also exhibits IGF-independent antiproliferative and apoptotic effects mediated by its receptor TMEM219/IGFBP-3R. .

Other Names: Insulin-like growth factor-binding protein 3, IBP-3, IGF-binding protein 3, IGFBP-3, IGFBP3, IBP3

Subcellular Localization: Secreted .

Tissue Specificity: Expressed by most tissues. Present in plasma.

Gene ID: 3486

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human IGFBP-3 (214-252aa RREMEDTLNHLKFLNVLSPRGVHIPNCDKKGFYKKKQCR), identical to the related mouse and rat sequences.

Calculated MW: 31674

Purification: Immunogen affinity purified.

Format: Lyophilized

Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
More Information
Is Featured? No
Write Your Own Review
You're reviewing:IGFBP-3 polyclonal, anti-human, rat