IGFBP1 polyclonal, anti-mouse, rat
€384.00
In stock
SKU
ARP-10-P9604
Quantity: 100 µg
Background:
IGFBP1, Insulin-like growth factor-binding protein 1, also known as placental protein 12 (PP12), is a protein that in humans is encoded by the IGFBP1 gene. The IGFBP1 gene has 4 exons and spans 5.9 kb. And the IGFBP1gene is localized to 7p13-p12 by in situ hybridization. This gene is a member of the Insulin-like growth factor-binding protein (IGFBP) family and encodes a protein with an IGFBP domain and a type-I thyroglobulin domain. The protein binds both insulin-like growth factors (IGFs) I and II and circulates in the plasma. Binding of this protein prolongs the half-life of the IGFs and alters their interaction with cell surface receptors. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.
Description:
Rabbit IgG polyclonal antibody for Insulin-like growth factor-binding protein 1 (IGFBP1) detection. Tested with WB, ELISA in Mouse, Rat.
Synonyms:
AFBP antibody, Alpha pregnancy associated endometrial globulin antibody, Amniotic fluid binding protein antibody, Binding protein 25 antibody, Binding protein 26 antibody, Binding protein 28 antibody, Growth hormone independent binding protein antibody, hIGFBP 1 antibody, hIGFBP1 antibody, IBP 1 antibody, IBP-1 antibody, IBP1 antibody, IBP1_HUMAN antibody, IGF binding protein 1 antibody, IGF BP25 antibody, IGF-binding protein 1 antibody, IGFBP 1 antibody, IGFBP-1 antibody, IGFBP1 antibody, Insulin Like Growth Factor Binding Protein 1 antibody, Insulin-like growth factor-binding protein 1 antibody, Placental protein 12 antibody, PP 12 antibody, PP12 antibody
Isotype: Rabbit polyclonal IgG
Immunogen:
A synthetic peptide corresponding to a sequence at the C-terminus of mouse IGFBP1 (177-207aa REIADLKKWKEPCQRELYKVLERLAAAQQKA), different from the related human sequence by eleven amino acids, and from the related rat sequence by one amino acid.A synthetic peptide corresponding to a sequence at the C-terminus of mouse IGFBP1 (177-207aa REIADLKKWKEPCQRELYKVLERLAAAQQKA), different from the related human sequence by eleven amino acids, and from the related rat sequence by one amino acid.
Form: Lyophilized; Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Specificity:
No cross reactivity with other proteins.
Reactivity: Reacts with: mouse, rat
Applications: WB, ELISA
Reconstitution:
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.
| Is Featured? | No |
|---|
Write Your Own Review